data_1WJF # _entry.id 1WJF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.291 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1WJF WWPDB D_1000177211 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1WJE _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WJF _pdbx_database_status.recvd_initial_deposition_date 1998-06-11 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cai, M.' 1 'Gronenborn, A.M.' 2 'Clore, G.M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of the His12 --> Cys mutant of the N-terminal zinc binding domain of HIV-1 integrase complexed to cadmium.' 'Protein Sci.' 7 2669 2674 1998 PRCIEI US 0961-8368 0795 ? 9865962 ? 1 'Solution Structure of the N-Terminal Zinc Binding Domain of HIV-1 Integrase' Nat.Struct.Biol. 4 567 ? 1997 NSBIEW US 1072-8368 2024 ? ? ? 2 'Erratum. Solution Structure of the N-Terminal Zinc Binding Domain of HIV-1 Integrase' Nat.Struct.Biol. 4 839 ? 1997 NSBIEW US 1072-8368 2024 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cai, M.' 1 primary 'Huang, Y.' 2 primary 'Caffrey, M.' 3 primary 'Zheng, R.' 4 primary 'Craigie, R.' 5 primary 'Clore, G.M.' 6 primary 'Gronenborn, A.M.' 7 1 'Cai, M.' 8 1 'Zheng, R.' 9 1 'Caffrey, M.' 10 1 'Craigie, R.' 11 1 'Clore, G.M.' 12 1 'Gronenborn, A.M.' 13 2 'Cai, M.' 14 2 'Zheng, R.' 15 2 'Caffrey, M.' 16 2 'Craigie, R.' 17 2 'Clore, G.M.' 18 2 'Gronenborn, A.M.' 19 # _cell.entry_id 1WJF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WJF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HIV-1 INTEGRASE' 6161.949 2 ? H12C ? ? 2 non-polymer syn 'CADMIUM ION' 112.411 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD _entity_poly.pdbx_seq_one_letter_code_can FLDGIDKAQEECEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVD _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 LEU n 1 3 ASP n 1 4 GLY n 1 5 ILE n 1 6 ASP n 1 7 LYS n 1 8 ALA n 1 9 GLN n 1 10 GLU n 1 11 GLU n 1 12 CYS n 1 13 GLU n 1 14 LYS n 1 15 TYR n 1 16 HIS n 1 17 SER n 1 18 ASN n 1 19 TRP n 1 20 ARG n 1 21 ALA n 1 22 MET n 1 23 ALA n 1 24 SER n 1 25 ASP n 1 26 PHE n 1 27 ASN n 1 28 LEU n 1 29 PRO n 1 30 PRO n 1 31 VAL n 1 32 VAL n 1 33 ALA n 1 34 LYS n 1 35 GLU n 1 36 ILE n 1 37 VAL n 1 38 ALA n 1 39 SER n 1 40 CYS n 1 41 ASP n 1 42 LYS n 1 43 CYS n 1 44 GLN n 1 45 LEU n 1 46 LYS n 1 47 GLY n 1 48 GLU n 1 49 ALA n 1 50 MET n 1 51 HIS n 1 52 GLY n 1 53 GLN n 1 54 VAL n 1 55 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene POTENTIAL _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene T7 _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type T7 _entity_src_gen.pdbx_host_org_vector 'T7 RNA POLYMERASE' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1B5 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04587 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;FFREDLAFLQGKAREFSSEQTRANSPTISSEQTRANSPTRRELQVWGRDNNSPSEAGADRQGTVSFNFPQITLWQRPLVT IKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQ IGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRK LVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGSGYQYNVLPQGW KGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYE LHPDKWTIQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEP VHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPI QKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTNRGRQKVVTLTHTT NQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS AGIRKILFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVI LVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSATVKAACWWAGIKQEFGIPYNPQSQGVVES MNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNP LWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1WJF A 1 ? 55 ? P04587 728 ? 782 ? 1 55 2 1 1WJF B 1 ? 55 ? P04587 728 ? 782 ? 1 55 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WJF CYS A 12 ? UNP P04587 HIS 739 'ENGINEERED MUTATION' 12 1 2 1WJF CYS B 12 ? UNP P04587 HIS 739 'ENGINEERED MUTATION' 12 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 DMX600 Bruker 500 2 DMX500 Bruker 600 # _pdbx_nmr_refine.entry_id 1WJF _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WJF _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE-KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ,RICE,SIMONSON,WARREN' 1 'structure solution' 'CNS MODIFIED' MODIFIED ? 2 # _exptl.entry_id 1WJF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1WJF _struct.title 'SOLUTION STRUCTURE OF H12C MUTANT OF THE N-TERMINAL ZN BINDING DOMAIN OF HIV-1 INTEGRASE COMPLEXED TO CADMIUM, NMR, 40 STRUCTURES' _struct.pdbx_descriptor 'HIV-1 INTEGRASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WJF _struct_keywords.pdbx_keywords 'ZN-BINDING PROTEIN' _struct_keywords.text 'ZN-BINDING PROTEIN, AIDS, POLYPROTEIN, HYDROLASE, ASPARTYL PROTEASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 3 ? TYR A 15 ? ASP A 3 TYR A 15 5 ? 13 HELX_P HELX_P2 2 TRP A 19 ? PHE A 26 ? TRP A 19 PHE A 26 1 ? 8 HELX_P HELX_P3 3 PRO A 30 ? SER A 39 ? PRO A 30 SER A 39 1 ? 10 HELX_P HELX_P4 4 ASP B 3 ? TYR B 15 ? ASP B 3 TYR B 15 5 ? 13 HELX_P HELX_P5 5 TRP B 19 ? PHE B 26 ? TRP B 19 PHE B 26 1 ? 8 HELX_P HELX_P6 6 PRO B 30 ? SER B 39 ? PRO B 30 SER B 39 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? C CD . CD ? ? ? 1_555 A CYS 12 SG ? ? A CD 56 A CYS 12 1_555 ? ? ? ? ? ? ? 2.612 ? metalc2 metalc ? ? C CD . CD ? ? ? 1_555 A CYS 40 SG ? ? A CD 56 A CYS 40 1_555 ? ? ? ? ? ? ? 2.591 ? metalc3 metalc ? ? C CD . CD ? ? ? 1_555 A CYS 43 SG ? ? A CD 56 A CYS 43 1_555 ? ? ? ? ? ? ? 2.609 ? metalc4 metalc ? ? D CD . CD ? ? ? 1_555 B CYS 12 SG ? ? B CD 56 B CYS 12 1_555 ? ? ? ? ? ? ? 2.611 ? metalc5 metalc ? ? D CD . CD ? ? ? 1_555 B CYS 40 SG ? ? B CD 56 B CYS 40 1_555 ? ? ? ? ? ? ? 2.592 ? metalc6 metalc ? ? D CD . CD ? ? ? 1_555 B CYS 43 SG ? ? B CD 56 B CYS 43 1_555 ? ? ? ? ? ? ? 2.608 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CD A 56' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CD B 56' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 CYS A 12 ? CYS A 12 . ? 1_555 ? 2 AC1 3 CYS A 40 ? CYS A 40 . ? 1_555 ? 3 AC1 3 CYS A 43 ? CYS A 43 . ? 1_555 ? 4 AC2 3 CYS B 12 ? CYS B 12 . ? 1_555 ? 5 AC2 3 CYS B 40 ? CYS B 40 . ? 1_555 ? 6 AC2 3 CYS B 43 ? CYS B 43 . ? 1_555 ? # _database_PDB_matrix.entry_id 1WJF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WJF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CD H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 1 1 PHE PHE A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASP 55 55 55 ASP ASP A . n B 1 1 PHE 1 1 1 PHE PHE B . n B 1 2 LEU 2 2 2 LEU LEU B . n B 1 3 ASP 3 3 3 ASP ASP B . n B 1 4 GLY 4 4 4 GLY GLY B . n B 1 5 ILE 5 5 5 ILE ILE B . n B 1 6 ASP 6 6 6 ASP ASP B . n B 1 7 LYS 7 7 7 LYS LYS B . n B 1 8 ALA 8 8 8 ALA ALA B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 GLU 11 11 11 GLU GLU B . n B 1 12 CYS 12 12 12 CYS CYS B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 LYS 14 14 14 LYS LYS B . n B 1 15 TYR 15 15 15 TYR TYR B . n B 1 16 HIS 16 16 16 HIS HIS B . n B 1 17 SER 17 17 17 SER SER B . n B 1 18 ASN 18 18 18 ASN ASN B . n B 1 19 TRP 19 19 19 TRP TRP B . n B 1 20 ARG 20 20 20 ARG ARG B . n B 1 21 ALA 21 21 21 ALA ALA B . n B 1 22 MET 22 22 22 MET MET B . n B 1 23 ALA 23 23 23 ALA ALA B . n B 1 24 SER 24 24 24 SER SER B . n B 1 25 ASP 25 25 25 ASP ASP B . n B 1 26 PHE 26 26 26 PHE PHE B . n B 1 27 ASN 27 27 27 ASN ASN B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 PRO 29 29 29 PRO PRO B . n B 1 30 PRO 30 30 30 PRO PRO B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 LYS 34 34 34 LYS LYS B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 ILE 36 36 36 ILE ILE B . n B 1 37 VAL 37 37 37 VAL VAL B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 SER 39 39 39 SER SER B . n B 1 40 CYS 40 40 40 CYS CYS B . n B 1 41 ASP 41 41 41 ASP ASP B . n B 1 42 LYS 42 42 42 LYS LYS B . n B 1 43 CYS 43 43 43 CYS CYS B . n B 1 44 GLN 44 44 44 GLN GLN B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 GLU 48 48 48 GLU GLU B . n B 1 49 ALA 49 49 49 ALA ALA B . n B 1 50 MET 50 50 50 MET MET B . n B 1 51 HIS 51 51 51 HIS HIS B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 GLN 53 53 53 GLN GLN B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 ASP 55 55 55 ASP ASP B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CD 1 56 56 CD CD A . D 2 CD 1 56 56 CD CD B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 12 ? A CYS 12 ? 1_555 CD ? C CD . ? A CD 56 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 112.5 ? 2 SG ? A CYS 12 ? A CYS 12 ? 1_555 CD ? C CD . ? A CD 56 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 112.0 ? 3 SG ? A CYS 40 ? A CYS 40 ? 1_555 CD ? C CD . ? A CD 56 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 105.8 ? 4 SG ? B CYS 12 ? B CYS 12 ? 1_555 CD ? D CD . ? B CD 56 ? 1_555 SG ? B CYS 40 ? B CYS 40 ? 1_555 112.5 ? 5 SG ? B CYS 12 ? B CYS 12 ? 1_555 CD ? D CD . ? B CD 56 ? 1_555 SG ? B CYS 43 ? B CYS 43 ? 1_555 112.1 ? 6 SG ? B CYS 40 ? B CYS 40 ? 1_555 CD ? D CD . ? B CD 56 ? 1_555 SG ? B CYS 43 ? B CYS 43 ? 1_555 105.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-12-16 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-03-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_assembly 2 4 'Structure model' pdbx_struct_oper_list 3 4 'Structure model' struct_ref_seq_dif # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement . ? 1 CNS phasing . ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 O B LYS 34 ? ? H B ALA 38 ? ? 1.55 2 4 O A LYS 34 ? ? H A ALA 38 ? ? 1.55 3 12 HH A TYR 15 ? ? OD2 A ASP 25 ? ? 1.54 4 12 HH B TYR 15 ? ? OD2 B ASP 25 ? ? 1.54 5 26 O A LYS 34 ? ? H A ALA 38 ? ? 1.57 6 26 O B LYS 34 ? ? H B ALA 38 ? ? 1.58 7 32 O A LYS 46 ? ? H A GLU 48 ? ? 1.55 8 32 O B LYS 46 ? ? H B GLU 48 ? ? 1.56 9 38 O A ALA 38 ? ? HE22 A GLN 44 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 16 ? ? 58.08 -134.68 2 1 GLU A 48 ? ? -86.62 -102.95 3 1 ALA A 49 ? ? -168.29 -135.00 4 1 HIS B 16 ? ? 58.12 -134.57 5 1 GLU B 48 ? ? -86.63 -102.79 6 1 ALA B 49 ? ? -168.33 -135.04 7 2 HIS A 16 ? ? 58.93 -139.48 8 2 GLN A 44 ? ? -78.04 -70.07 9 2 ALA A 49 ? ? 47.78 -143.15 10 2 MET A 50 ? ? 40.00 -88.56 11 2 HIS B 16 ? ? 58.96 -139.57 12 2 GLN B 44 ? ? -77.99 -70.02 13 2 ALA B 49 ? ? 47.84 -143.10 14 2 MET B 50 ? ? 39.93 -89.18 15 3 HIS A 16 ? ? 58.04 -126.58 16 3 GLN A 44 ? ? -78.90 -70.08 17 3 GLU A 48 ? ? -89.20 -77.93 18 3 ALA A 49 ? ? -165.75 -50.09 19 3 HIS B 16 ? ? 57.96 -126.67 20 3 GLU B 48 ? ? -89.28 -78.11 21 3 ALA B 49 ? ? -165.62 -50.03 22 4 HIS A 16 ? ? 58.22 -138.27 23 4 PRO A 30 ? ? -38.94 -20.71 24 4 LYS A 46 ? ? -75.90 20.20 25 4 HIS B 16 ? ? 58.24 -138.69 26 4 PRO B 30 ? ? -39.04 -20.55 27 5 HIS A 16 ? ? 56.71 -127.01 28 5 GLN A 53 ? ? -152.34 -76.65 29 5 HIS B 16 ? ? 56.73 -126.86 30 5 GLN B 53 ? ? -152.44 -76.58 31 6 HIS A 16 ? ? 56.51 -119.14 32 6 PRO A 30 ? ? -39.06 -25.81 33 6 GLN A 44 ? ? -78.86 -70.10 34 6 ALA A 49 ? ? -166.95 78.71 35 6 MET A 50 ? ? -160.45 102.02 36 6 GLN A 53 ? ? -156.15 -18.45 37 6 VAL A 54 ? ? -90.10 -73.40 38 6 HIS B 16 ? ? 56.50 -119.25 39 6 PRO B 30 ? ? -38.99 -25.96 40 6 ALA B 49 ? ? -167.02 78.79 41 6 MET B 50 ? ? -160.63 101.09 42 6 GLN B 53 ? ? -156.16 -18.47 43 6 VAL B 54 ? ? -90.05 -73.36 44 7 HIS A 16 ? ? 57.64 -133.03 45 7 PRO A 30 ? ? -38.03 -22.43 46 7 ALA A 49 ? ? -78.29 -110.43 47 7 MET A 50 ? ? 55.96 157.74 48 7 HIS B 16 ? ? 57.45 -133.05 49 7 PRO B 30 ? ? -38.24 -22.32 50 7 ALA B 49 ? ? -78.25 -110.35 51 7 MET B 50 ? ? 55.70 157.16 52 8 HIS A 16 ? ? 57.81 -137.09 53 8 GLN A 44 ? ? -78.99 -70.00 54 8 ALA A 49 ? ? -165.82 -62.34 55 8 HIS B 16 ? ? 57.72 -137.20 56 8 GLN B 44 ? ? -79.19 -70.08 57 8 ALA B 49 ? ? -165.70 -62.43 58 9 HIS A 16 ? ? 56.87 -132.90 59 9 ALA A 49 ? ? -167.84 -68.41 60 9 HIS B 16 ? ? 56.93 -132.71 61 9 ALA B 49 ? ? -167.84 -68.82 62 10 HIS A 16 ? ? 59.04 -138.40 63 10 GLU A 48 ? ? -153.94 75.21 64 10 GLN A 53 ? ? -79.96 -70.07 65 10 VAL A 54 ? ? -144.26 -28.59 66 10 HIS B 16 ? ? 58.97 -138.32 67 10 GLU B 48 ? ? -153.93 75.13 68 10 GLN B 53 ? ? -80.02 -70.15 69 10 VAL B 54 ? ? -144.23 -28.43 70 11 HIS A 16 ? ? 58.60 -139.56 71 11 GLU A 48 ? ? -149.20 -57.73 72 11 ALA A 49 ? ? 38.48 -89.97 73 11 MET A 50 ? ? -160.35 71.29 74 11 HIS B 16 ? ? 58.66 -139.39 75 11 GLU B 48 ? ? -149.04 -57.73 76 11 ALA B 49 ? ? 38.63 -89.97 77 11 MET B 50 ? ? -160.39 70.55 78 12 HIS A 16 ? ? 59.26 -134.37 79 12 VAL A 54 ? ? -90.04 -77.80 80 12 HIS B 16 ? ? 59.39 -134.41 81 12 VAL B 54 ? ? -89.96 -77.84 82 13 HIS A 16 ? ? 58.04 -134.50 83 13 ALA A 49 ? ? 73.42 122.17 84 13 MET A 50 ? ? -159.56 -48.75 85 13 HIS B 16 ? ? 58.08 -134.44 86 13 ALA B 49 ? ? 73.58 121.95 87 13 MET B 50 ? ? -159.35 -49.03 88 14 HIS A 16 ? ? 59.11 -133.70 89 14 ALA A 49 ? ? -68.78 -82.53 90 14 MET A 50 ? ? 54.88 11.29 91 14 HIS B 16 ? ? 59.11 -133.62 92 14 ALA B 49 ? ? -68.92 -82.38 93 14 MET B 50 ? ? 54.59 11.35 94 15 HIS A 16 ? ? 58.07 -136.02 95 15 GLN A 44 ? ? -77.63 -70.18 96 15 ALA A 49 ? ? 84.76 -147.13 97 15 HIS B 16 ? ? 58.36 -135.93 98 15 GLN B 44 ? ? -77.58 -70.28 99 15 ALA B 49 ? ? 84.39 -147.59 100 16 HIS A 16 ? ? 59.01 -137.19 101 16 PRO A 29 ? ? -47.37 178.51 102 16 GLN A 44 ? ? -77.42 -70.11 103 16 ALA A 49 ? ? -68.84 -106.52 104 16 MET A 50 ? ? 39.52 49.92 105 16 GLN A 53 ? ? -150.49 -20.27 106 16 HIS B 16 ? ? 59.10 -137.55 107 16 PRO B 29 ? ? -47.36 178.36 108 16 ALA B 49 ? ? -69.09 -106.74 109 16 MET B 50 ? ? 39.98 49.45 110 16 GLN B 53 ? ? -150.36 -20.52 111 17 HIS A 16 ? ? 57.06 -125.34 112 17 MET A 50 ? ? 59.74 16.90 113 17 HIS B 16 ? ? 57.15 -125.15 114 17 MET B 50 ? ? 59.56 16.86 115 18 HIS A 16 ? ? 59.32 -140.32 116 18 GLU A 48 ? ? -155.10 -48.83 117 18 ALA A 49 ? ? 38.29 -129.34 118 18 GLN A 53 ? ? 52.60 103.65 119 18 HIS B 16 ? ? 59.35 -140.23 120 18 GLU B 48 ? ? -155.04 -48.66 121 18 ALA B 49 ? ? 38.17 -129.46 122 18 GLN B 53 ? ? 52.55 103.58 123 19 HIS A 16 ? ? 58.58 -135.39 124 19 PRO A 30 ? ? -39.81 -19.87 125 19 MET A 50 ? ? -163.15 -23.77 126 19 HIS B 16 ? ? 58.45 -135.34 127 19 PRO B 30 ? ? -39.64 -20.10 128 19 MET B 50 ? ? -162.95 -24.54 129 20 HIS A 16 ? ? 57.42 -137.37 130 20 ALA A 49 ? ? -74.93 -128.22 131 20 HIS A 51 ? ? -152.26 -61.31 132 20 GLN A 53 ? ? -80.05 -70.02 133 20 HIS B 16 ? ? 57.41 -137.34 134 20 GLN B 44 ? ? -77.76 -70.05 135 20 ALA B 49 ? ? -74.94 -128.06 136 20 HIS B 51 ? ? -152.20 -61.61 137 20 GLN B 53 ? ? -79.96 -70.05 138 21 HIS A 16 ? ? 58.67 -137.63 139 21 ALA A 49 ? ? -164.22 14.25 140 21 MET A 50 ? ? -79.26 -94.40 141 21 HIS B 16 ? ? 58.61 -137.84 142 21 ALA B 49 ? ? -164.19 14.27 143 21 MET B 50 ? ? -79.39 -94.63 144 22 HIS A 16 ? ? 58.46 -134.42 145 22 ALA A 49 ? ? 44.25 -146.02 146 22 HIS B 16 ? ? 58.56 -134.50 147 22 ALA B 49 ? ? 44.46 -146.40 148 23 HIS A 16 ? ? 58.44 -135.36 149 23 GLU A 48 ? ? -153.40 83.09 150 23 HIS B 16 ? ? 58.84 -135.13 151 23 GLU B 48 ? ? -153.37 82.84 152 24 HIS A 16 ? ? 57.74 -136.17 153 24 PRO A 30 ? ? -39.77 -21.68 154 24 LYS A 46 ? ? -79.99 -70.10 155 24 GLU A 48 ? ? -85.50 38.05 156 24 HIS B 16 ? ? 57.60 -136.34 157 24 PRO B 30 ? ? -39.75 -21.62 158 24 GLU B 48 ? ? -85.31 38.12 159 25 HIS A 16 ? ? 57.57 -126.74 160 25 PRO A 29 ? ? -46.49 153.63 161 25 MET A 50 ? ? -161.03 2.37 162 25 HIS B 16 ? ? 57.30 -127.01 163 25 PRO B 29 ? ? -46.37 153.50 164 25 MET B 50 ? ? -160.71 2.33 165 26 HIS A 16 ? ? 58.73 -132.04 166 26 MET A 50 ? ? -82.53 -102.08 167 26 HIS B 16 ? ? 58.73 -131.98 168 26 MET B 50 ? ? -82.73 -101.39 169 27 HIS A 16 ? ? 58.49 -137.33 170 27 ALA A 49 ? ? 40.76 -83.98 171 27 GLN A 53 ? ? -161.28 -57.00 172 27 HIS B 16 ? ? 58.66 -137.31 173 27 ALA B 49 ? ? 40.75 -84.18 174 27 GLN B 53 ? ? -161.09 -57.17 175 28 HIS A 16 ? ? 58.99 -138.50 176 28 ALA A 49 ? ? 38.01 -89.91 177 28 MET A 50 ? ? -82.06 -76.00 178 28 HIS A 51 ? ? -156.64 42.37 179 28 HIS B 16 ? ? 59.24 -138.20 180 28 ALA B 49 ? ? 37.99 -90.07 181 28 MET B 50 ? ? -81.83 -76.01 182 28 HIS B 51 ? ? -156.70 42.45 183 29 HIS A 16 ? ? 58.06 -134.07 184 29 ALA A 49 ? ? -160.85 57.45 185 29 HIS B 16 ? ? 58.11 -134.05 186 29 ALA B 49 ? ? -160.87 57.07 187 30 HIS A 16 ? ? 58.38 -138.43 188 30 PRO A 30 ? ? -40.64 -19.98 189 30 ALA A 49 ? ? -77.55 -169.11 190 30 MET A 50 ? ? 55.90 159.97 191 30 GLN A 53 ? ? -148.38 33.78 192 30 HIS B 16 ? ? 58.29 -138.22 193 30 ALA B 49 ? ? -77.62 -169.28 194 30 MET B 50 ? ? 55.82 159.46 195 30 GLN B 53 ? ? -148.44 33.90 196 31 HIS A 16 ? ? 59.37 -136.73 197 31 GLN A 44 ? ? -78.20 -70.04 198 31 HIS B 16 ? ? 59.52 -136.68 199 32 HIS A 16 ? ? 58.82 -133.56 200 32 HIS B 16 ? ? 58.81 -133.76 201 33 HIS A 16 ? ? 59.41 -134.09 202 33 PRO A 30 ? ? -38.31 -22.40 203 33 ALA A 49 ? ? -70.41 -165.11 204 33 MET A 50 ? ? 75.11 -69.95 205 33 HIS A 51 ? ? -153.83 -46.91 206 33 HIS B 16 ? ? 59.36 -134.20 207 33 PRO B 30 ? ? -38.38 -22.47 208 33 LYS B 46 ? ? -79.94 -70.03 209 33 ALA B 49 ? ? -70.52 -165.19 210 33 MET B 50 ? ? 75.23 -70.22 211 33 HIS B 51 ? ? -153.56 -47.08 212 34 HIS A 16 ? ? 57.61 -128.80 213 34 GLU A 48 ? ? -89.41 -79.97 214 34 HIS B 16 ? ? 57.71 -128.75 215 34 GLU B 48 ? ? -89.39 -80.06 216 35 HIS A 16 ? ? 58.96 -139.02 217 35 ALA A 49 ? ? -72.60 -84.61 218 35 VAL A 54 ? ? -90.04 -73.47 219 35 HIS B 16 ? ? 58.69 -139.13 220 35 ALA B 49 ? ? -72.73 -84.70 221 35 VAL B 54 ? ? -89.96 -73.02 222 36 HIS A 16 ? ? 59.74 -137.28 223 36 HIS B 16 ? ? 59.85 -137.52 224 37 HIS A 16 ? ? 58.99 -135.99 225 37 PRO A 30 ? ? -39.87 -23.77 226 37 GLN A 44 ? ? -77.07 -71.15 227 37 ALA A 49 ? ? -170.25 -13.47 228 37 HIS B 16 ? ? 58.87 -136.16 229 37 GLN B 44 ? ? -77.08 -71.14 230 37 ALA B 49 ? ? -170.16 -13.73 231 38 HIS A 16 ? ? 57.64 -136.95 232 38 ALA A 49 ? ? 32.10 -98.00 233 38 VAL A 54 ? ? -90.17 -73.79 234 38 HIS B 16 ? ? 57.62 -137.24 235 38 ALA B 49 ? ? 31.97 -98.35 236 38 VAL B 54 ? ? -89.95 -73.94 237 39 HIS A 16 ? ? 57.97 -138.44 238 39 GLN A 53 ? ? 40.23 -86.46 239 39 HIS B 16 ? ? 58.18 -138.59 240 39 GLN B 53 ? ? 40.10 -86.62 241 40 HIS A 16 ? ? 56.92 -127.19 242 40 MET A 50 ? ? 77.82 -18.45 243 40 HIS B 16 ? ? 56.86 -127.47 244 40 MET B 50 ? ? 77.64 -18.73 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CADMIUM ION' _pdbx_entity_nonpoly.comp_id CD #