data_1WJH # _entry.id 1WJH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1WJH RCSB RCSB023641 WWPDB D_1000023641 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2007-02-27 _pdbx_database_PDB_obs_spr.pdb_id 2ECC _pdbx_database_PDB_obs_spr.replace_pdb_id 1WJH _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 1WJH _pdbx_database_status.recvd_initial_deposition_date 2004-05-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kamatari, Y.O.' 1 'Tochio, N.' 2 'Nameki, N.' 3 'Miyamoto, K.' 4 'Li, H.' 5 'Kobayashi, N.' 6 'Koshiba, S.' 7 'Inoue, M.' 8 'Kigawa, T.' 9 'Yokoyama, S.' 10 # _citation.id primary _citation.title 'Solution Structure of the Homeobox Domain of Human Homeodomain Leucine Zipper-Encoding Gene (Homez)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kamatari, Y.O.' 1 primary 'Tochio, N.' 2 primary 'Nameki, N.' 3 primary 'Miyamoto, K.' 4 primary 'Li, H.' 5 primary 'Kobayashi, N.' 6 primary 'Koshiba, S.' 7 primary 'Inoue, M.' 8 primary 'Kigawa, T.' 9 primary 'Yokoyama, S.' 10 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Homeobox-leucine zipper protein Homez' _entity.formula_weight 8729.859 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'homeobox domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'homeodomain leucine zipper-encoding gene (Homez), Homeodomain leucine zipper- containing factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGKRKTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFRDNASGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGKRKTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFRDNASGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 ARG n 1 10 LYS n 1 11 THR n 1 12 LYS n 1 13 GLU n 1 14 GLN n 1 15 LEU n 1 16 ALA n 1 17 ILE n 1 18 LEU n 1 19 LYS n 1 20 SER n 1 21 PHE n 1 22 PHE n 1 23 LEU n 1 24 GLN n 1 25 CYS n 1 26 GLN n 1 27 TRP n 1 28 ALA n 1 29 ARG n 1 30 ARG n 1 31 GLU n 1 32 ASP n 1 33 TYR n 1 34 GLN n 1 35 LYS n 1 36 LEU n 1 37 GLU n 1 38 GLN n 1 39 ILE n 1 40 THR n 1 41 GLY n 1 42 LEU n 1 43 PRO n 1 44 ARG n 1 45 PRO n 1 46 GLU n 1 47 ILE n 1 48 ILE n 1 49 GLN n 1 50 TRP n 1 51 PHE n 1 52 GLY n 1 53 ASP n 1 54 THR n 1 55 ARG n 1 56 TYR n 1 57 ALA n 1 58 LEU n 1 59 LYS n 1 60 HIS n 1 61 GLY n 1 62 GLN n 1 63 LEU n 1 64 LYS n 1 65 TRP n 1 66 PHE n 1 67 ARG n 1 68 ASP n 1 69 ASN n 1 70 ALA n 1 71 SER n 1 72 GLY n 1 73 PRO n 1 74 SER n 1 75 SER n 1 76 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KAZUSA cDNA hj01820b' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040126-87 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HOMZ_HUMAN _struct_ref.pdbx_db_accession Q8IX15 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KRKTKEQLAILKSFFLQCQWARREDYQKLEQITGLPRPEIIQWFGDTRYALKHGQLKWFRDNA _struct_ref.pdbx_align_begin 337 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WJH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IX15 _struct_ref_seq.db_align_beg 337 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 399 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WJH GLY A 1 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 1 1 1 1WJH SER A 2 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 2 2 1 1WJH SER A 3 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 3 3 1 1WJH GLY A 4 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 4 4 1 1WJH SER A 5 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 5 5 1 1WJH SER A 6 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 6 6 1 1WJH GLY A 7 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 7 7 1 1WJH SER A 71 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 71 8 1 1WJH GLY A 72 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 72 9 1 1WJH PRO A 73 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 73 10 1 1WJH SER A 74 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 74 11 1 1WJH SER A 75 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 75 12 1 1WJH GLY A 76 ? UNP Q8IX15 ? ? 'CLONING ARTIFACT' 76 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.14mM homeobox domain U-13C, 15N; 20mM d-Tris-HCl buffer (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1WJH _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WJH _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WJH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XWINNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B. A.' 3 Kujira 0.8998 'data analysis' 'Kobayashi, N.' 4 CYANA 2.0.17 'structure solution' 'Guentert, P.' 5 CYANA 2.0.17 refinement 'Guentert, P.' 6 # _exptl.entry_id 1WJH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WJH _struct.title 'Solution Structure of the Homeobox Domain of Human Homeodomain Leucine Zipper-Encoding Gene (Homez)' _struct.pdbx_descriptor 'Homeobox-leucine zipper protein Homez' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WJH _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'homeobox domain, homeodomain leucine zipper-encoding gene, Homez, structural genomics, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 11 ? CYS A 25 ? THR A 11 CYS A 25 1 ? 15 HELX_P HELX_P2 2 ARG A 29 ? THR A 40 ? ARG A 29 THR A 40 1 ? 12 HELX_P HELX_P3 3 PRO A 43 ? HIS A 60 ? PRO A 43 HIS A 60 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1WJH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WJH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-29 2 'Structure model' 1 1 2007-02-27 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -120.32 -55.90 2 1 ASN A 69 ? ? -61.86 86.49 3 2 LYS A 10 ? ? -40.96 162.11 4 3 SER A 3 ? ? -132.77 -53.92 5 3 LYS A 10 ? ? -47.23 167.55 6 3 LEU A 23 ? ? -39.86 -32.68 7 3 PRO A 73 ? ? -69.72 87.37 8 4 SER A 2 ? ? -103.65 42.05 9 4 ALA A 70 ? ? -65.96 81.02 10 4 PRO A 73 ? ? -69.80 95.79 11 5 SER A 3 ? ? -35.93 123.79 12 5 SER A 5 ? ? -56.55 103.69 13 5 LYS A 10 ? ? -44.32 168.13 14 5 LEU A 23 ? ? -39.93 -28.69 15 5 SER A 75 ? ? -48.52 158.76 16 6 LYS A 10 ? ? -48.25 166.41 17 6 ASP A 68 ? ? -91.14 48.09 18 6 ALA A 70 ? ? 35.09 45.45 19 7 SER A 3 ? ? -52.51 178.11 20 7 LEU A 23 ? ? -39.99 -29.27 21 7 ALA A 70 ? ? -64.71 96.03 22 8 SER A 5 ? ? -170.42 134.33 23 8 LEU A 23 ? ? -39.78 -31.64 24 8 ALA A 70 ? ? -34.21 105.69 25 8 PRO A 73 ? ? -69.81 86.53 26 9 SER A 74 ? ? -168.95 119.54 27 10 SER A 5 ? ? -100.68 41.01 28 10 GLN A 34 ? ? -39.93 -25.27 29 11 GLN A 34 ? ? -38.14 -29.48 30 11 ASN A 69 ? ? -168.07 108.82 31 11 SER A 71 ? ? -35.49 137.03 32 12 SER A 5 ? ? -131.46 -53.69 33 12 ARG A 9 ? ? -43.56 157.41 34 13 TRP A 27 ? ? -111.99 76.28 35 14 SER A 3 ? ? -126.15 -55.80 36 14 TRP A 27 ? ? -108.76 75.08 37 14 ASN A 69 ? ? -95.24 42.12 38 15 ARG A 9 ? ? -35.59 123.54 39 15 ASP A 68 ? ? -109.62 45.15 40 15 SER A 71 ? ? -174.96 107.73 41 16 TRP A 27 ? ? -111.42 79.91 42 16 ASP A 68 ? ? -96.33 -65.45 43 16 ASN A 69 ? ? -35.18 149.65 44 16 SER A 71 ? ? -175.00 132.95 45 16 PRO A 73 ? ? -69.67 83.61 46 17 LEU A 23 ? ? -39.93 -32.81 47 18 ASN A 69 ? ? -94.67 47.82 48 19 LYS A 10 ? ? -46.76 160.20 49 19 ALA A 70 ? ? 34.87 39.63 50 19 SER A 71 ? ? -170.67 146.13 51 19 PRO A 73 ? ? -69.72 89.25 52 20 SER A 5 ? ? 35.06 41.89 53 20 ARG A 9 ? ? -38.66 147.80 54 20 LYS A 10 ? ? -47.74 160.51 55 20 TRP A 27 ? ? -109.51 73.13 56 20 PRO A 73 ? ? -69.73 98.40 #