data_1WJN # _entry.id 1WJN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WJN pdb_00001wjn 10.2210/pdb1wjn/pdb RCSB RCSB023647 ? ? WWPDB D_1000023647 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-29 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WJN _pdbx_database_status.recvd_initial_deposition_date 2004-05-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007104802.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Tochio, N.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of the C-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Tochio, N.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Tubulin-folding protein TBCE' _entity.formula_weight 10702.256 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'ubiquitin like-domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'tubulin-specific chaperone e' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGQLLTLKIKCSNQPERQILEKQLPDSMTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYS VENGDCLLVRWSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGQLLTLKIKCSNQPERQILEKQLPDSMTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYS VENGDCLLVRWSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007104802.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 LEU n 1 10 LEU n 1 11 THR n 1 12 LEU n 1 13 LYS n 1 14 ILE n 1 15 LYS n 1 16 CYS n 1 17 SER n 1 18 ASN n 1 19 GLN n 1 20 PRO n 1 21 GLU n 1 22 ARG n 1 23 GLN n 1 24 ILE n 1 25 LEU n 1 26 GLU n 1 27 LYS n 1 28 GLN n 1 29 LEU n 1 30 PRO n 1 31 ASP n 1 32 SER n 1 33 MET n 1 34 THR n 1 35 VAL n 1 36 GLN n 1 37 LYS n 1 38 VAL n 1 39 LYS n 1 40 GLY n 1 41 LEU n 1 42 LEU n 1 43 SER n 1 44 ARG n 1 45 LEU n 1 46 LEU n 1 47 LYS n 1 48 VAL n 1 49 PRO n 1 50 VAL n 1 51 SER n 1 52 GLU n 1 53 LEU n 1 54 LEU n 1 55 LEU n 1 56 SER n 1 57 TYR n 1 58 GLU n 1 59 SER n 1 60 SER n 1 61 LYS n 1 62 MET n 1 63 PRO n 1 64 GLY n 1 65 ARG n 1 66 GLU n 1 67 ILE n 1 68 GLU n 1 69 LEU n 1 70 GLU n 1 71 ASN n 1 72 ASP n 1 73 LEU n 1 74 GLN n 1 75 PRO n 1 76 LEU n 1 77 GLN n 1 78 PHE n 1 79 TYR n 1 80 SER n 1 81 VAL n 1 82 GLU n 1 83 ASN n 1 84 GLY n 1 85 ASP n 1 86 CYS n 1 87 LEU n 1 88 LEU n 1 89 VAL n 1 90 ARG n 1 91 TRP n 1 92 SER n 1 93 GLY n 1 94 PRO n 1 95 SER n 1 96 SER n 1 97 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA 2610206D02' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040301-91 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n # _exptl.entry_id 1WJN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WJN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WJN _struct.title 'Solution structure of the C-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WJN _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text ;ubiquitin-like domain, progressive motor neuropathy, tubulin-folding protein TBCE, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CHAPERONE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TBCE_MOUSE _struct_ref.pdbx_db_accession Q8CIV8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QLLTLKIKCSNQPERQILEKQLPDSMTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYSVENGDCL LVRW ; _struct_ref.pdbx_align_begin 441 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WJN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8CIV8 _struct_ref_seq.db_align_beg 441 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 524 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WJN GLY A 1 ? UNP Q8CIV8 ? ? 'cloning artifact' 1 1 1 1WJN SER A 2 ? UNP Q8CIV8 ? ? 'cloning artifact' 2 2 1 1WJN SER A 3 ? UNP Q8CIV8 ? ? 'cloning artifact' 3 3 1 1WJN GLY A 4 ? UNP Q8CIV8 ? ? 'cloning artifact' 4 4 1 1WJN SER A 5 ? UNP Q8CIV8 ? ? 'cloning artifact' 5 5 1 1WJN SER A 6 ? UNP Q8CIV8 ? ? 'cloning artifact' 6 6 1 1WJN GLY A 7 ? UNP Q8CIV8 ? ? 'cloning artifact' 7 7 1 1WJN SER A 92 ? UNP Q8CIV8 ? ? 'cloning artifact' 92 8 1 1WJN GLY A 93 ? UNP Q8CIV8 ? ? 'cloning artifact' 93 9 1 1WJN PRO A 94 ? UNP Q8CIV8 ? ? 'cloning artifact' 94 10 1 1WJN SER A 95 ? UNP Q8CIV8 ? ? 'cloning artifact' 95 11 1 1WJN SER A 96 ? UNP Q8CIV8 ? ? 'cloning artifact' 96 12 1 1WJN GLY A 97 ? UNP Q8CIV8 ? ? 'cloning artifact' 97 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 34 ? ARG A 44 ? THR A 34 ARG A 44 1 ? 11 HELX_P HELX_P2 2 LEU A 76 ? SER A 80 ? LEU A 76 SER A 80 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 25 ? PRO A 30 ? LEU A 25 PRO A 30 A 2 LEU A 9 ? CYS A 16 ? LEU A 9 CYS A 16 A 3 CYS A 86 ? ARG A 90 ? CYS A 86 ARG A 90 A 4 LEU A 54 ? GLU A 58 ? LEU A 54 GLU A 58 A 5 GLU A 66 ? GLU A 68 ? GLU A 66 GLU A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 29 ? O LEU A 29 N LEU A 10 ? N LEU A 10 A 2 3 N LYS A 13 ? N LYS A 13 O LEU A 87 ? O LEU A 87 A 3 4 O ARG A 90 ? O ARG A 90 N LEU A 54 ? N LEU A 54 A 4 5 N TYR A 57 ? N TYR A 57 O ILE A 67 ? O ILE A 67 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 23 ? ? -47.13 161.45 2 1 MET A 33 ? ? -39.89 135.22 3 1 VAL A 35 ? ? -36.67 -32.60 4 1 ASN A 83 ? ? -38.60 143.85 5 1 ASP A 85 ? ? -55.55 178.33 6 2 SER A 3 ? ? -59.76 174.94 7 2 SER A 6 ? ? -98.83 36.53 8 2 ARG A 22 ? ? -41.68 103.94 9 2 LEU A 73 ? ? -84.22 34.15 10 2 SER A 95 ? ? -116.52 57.04 11 3 ARG A 22 ? ? -58.44 109.18 12 3 GLN A 23 ? ? -49.27 155.93 13 3 MET A 33 ? ? -39.80 122.71 14 3 LEU A 69 ? ? -65.21 96.93 15 3 ASP A 85 ? ? -54.90 172.71 16 4 ASN A 18 ? ? 44.96 25.48 17 4 ASP A 85 ? ? -58.12 170.14 18 4 SER A 96 ? ? -121.95 -56.51 19 5 SER A 5 ? ? 47.90 26.48 20 5 ARG A 22 ? ? -38.71 103.53 21 5 GLN A 23 ? ? -35.97 141.22 22 5 ASP A 31 ? ? -39.61 -26.27 23 5 PRO A 75 ? ? -69.72 -178.55 24 5 ASP A 85 ? ? -49.20 176.52 25 6 ARG A 22 ? ? -39.32 113.86 26 6 PRO A 75 ? ? -69.77 -174.50 27 6 ASP A 85 ? ? -52.34 179.92 28 6 SER A 95 ? ? -44.23 109.74 29 7 SER A 3 ? ? -131.34 -53.04 30 7 SER A 5 ? ? -49.36 166.50 31 7 VAL A 35 ? ? -38.19 -37.78 32 7 SER A 43 ? ? -37.45 -38.47 33 7 LYS A 47 ? ? 38.74 35.20 34 7 ASP A 85 ? ? -55.21 -175.93 35 8 ASP A 85 ? ? -57.10 -179.28 36 8 PRO A 94 ? ? -69.71 83.53 37 9 SER A 5 ? ? -48.71 160.22 38 9 ASP A 85 ? ? -48.22 161.30 39 10 LEU A 45 ? ? -90.23 -62.03 40 10 LEU A 73 ? ? -85.56 30.14 41 10 ASP A 85 ? ? -56.00 177.59 42 11 GLN A 23 ? ? -40.00 159.63 43 11 VAL A 35 ? ? -38.45 -32.83 44 11 MET A 62 ? ? -115.69 78.44 45 11 ASP A 85 ? ? -45.21 170.23 46 12 VAL A 35 ? ? -39.89 -36.12 47 12 TRP A 91 ? ? -174.70 140.56 48 13 SER A 6 ? ? -41.62 153.67 49 13 ARG A 22 ? ? -46.43 104.85 50 13 GLN A 23 ? ? -48.71 167.76 51 13 LEU A 53 ? ? -44.29 104.74 52 13 ASP A 85 ? ? -50.41 176.76 53 13 TRP A 91 ? ? -175.02 144.69 54 14 SER A 6 ? ? -90.30 43.43 55 14 ARG A 22 ? ? -38.28 104.88 56 14 SER A 43 ? ? -39.11 -39.47 57 14 LYS A 47 ? ? 48.71 25.21 58 14 SER A 59 ? ? -57.78 175.94 59 14 MET A 62 ? ? -107.39 71.14 60 14 LEU A 73 ? ? -88.40 35.95 61 14 ASP A 85 ? ? -54.68 -177.72 62 14 PRO A 94 ? ? -69.79 96.59 63 15 ARG A 22 ? ? -42.59 109.06 64 15 SER A 43 ? ? -33.86 -34.15 65 15 LEU A 73 ? ? -85.12 34.51 66 15 ASN A 83 ? ? -39.61 142.28 67 15 ASP A 85 ? ? -49.45 177.06 68 15 SER A 95 ? ? -35.62 96.70 69 16 MET A 33 ? ? -46.00 150.32 70 16 VAL A 35 ? ? -39.34 -38.19 71 16 ARG A 65 ? ? -161.65 117.42 72 17 SER A 3 ? ? -86.56 41.60 73 17 SER A 5 ? ? -101.57 41.07 74 17 LYS A 47 ? ? 32.76 51.99 75 17 LEU A 73 ? ? -87.32 33.24 76 17 ASP A 85 ? ? -53.48 176.11 77 18 VAL A 35 ? ? -34.93 -34.31 78 18 SER A 43 ? ? -34.02 -33.78 79 18 GLU A 70 ? ? -92.62 -62.46 80 18 SER A 96 ? ? -47.07 153.37 81 19 GLN A 23 ? ? -60.45 -178.68 82 19 LEU A 53 ? ? -39.20 110.20 83 19 ASN A 83 ? ? -39.40 140.31 84 19 ASP A 85 ? ? -46.40 167.14 85 20 SER A 3 ? ? -47.66 155.10 86 20 LYS A 47 ? ? 48.30 28.46 87 20 LEU A 53 ? ? -38.82 100.00 88 20 LEU A 73 ? ? -96.56 30.67 89 20 ASP A 85 ? ? -51.65 -177.69 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1WJN _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WJN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.1mM ubiquitin-like domain U-15N,13C; 20mM d-Tris-HCl; 200mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 220mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1WJN _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.5 collection Bruker 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.8994 'data analysis' 'Kobayashi, N.' 4 CYANA 2.0.17 'structure solution' 'Guentert, P.' 5 CYANA 2.0.17 refinement 'Guentert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TRP N N N N 284 TRP CA C N S 285 TRP C C N N 286 TRP O O N N 287 TRP CB C N N 288 TRP CG C Y N 289 TRP CD1 C Y N 290 TRP CD2 C Y N 291 TRP NE1 N Y N 292 TRP CE2 C Y N 293 TRP CE3 C Y N 294 TRP CZ2 C Y N 295 TRP CZ3 C Y N 296 TRP CH2 C Y N 297 TRP OXT O N N 298 TRP H H N N 299 TRP H2 H N N 300 TRP HA H N N 301 TRP HB2 H N N 302 TRP HB3 H N N 303 TRP HD1 H N N 304 TRP HE1 H N N 305 TRP HE3 H N N 306 TRP HZ2 H N N 307 TRP HZ3 H N N 308 TRP HH2 H N N 309 TRP HXT H N N 310 TYR N N N N 311 TYR CA C N S 312 TYR C C N N 313 TYR O O N N 314 TYR CB C N N 315 TYR CG C Y N 316 TYR CD1 C Y N 317 TYR CD2 C Y N 318 TYR CE1 C Y N 319 TYR CE2 C Y N 320 TYR CZ C Y N 321 TYR OH O N N 322 TYR OXT O N N 323 TYR H H N N 324 TYR H2 H N N 325 TYR HA H N N 326 TYR HB2 H N N 327 TYR HB3 H N N 328 TYR HD1 H N N 329 TYR HD2 H N N 330 TYR HE1 H N N 331 TYR HE2 H N N 332 TYR HH H N N 333 TYR HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 GLY N CA sing N N 108 GLY N H sing N N 109 GLY N H2 sing N N 110 GLY CA C sing N N 111 GLY CA HA2 sing N N 112 GLY CA HA3 sing N N 113 GLY C O doub N N 114 GLY C OXT sing N N 115 GLY OXT HXT sing N N 116 ILE N CA sing N N 117 ILE N H sing N N 118 ILE N H2 sing N N 119 ILE CA C sing N N 120 ILE CA CB sing N N 121 ILE CA HA sing N N 122 ILE C O doub N N 123 ILE C OXT sing N N 124 ILE CB CG1 sing N N 125 ILE CB CG2 sing N N 126 ILE CB HB sing N N 127 ILE CG1 CD1 sing N N 128 ILE CG1 HG12 sing N N 129 ILE CG1 HG13 sing N N 130 ILE CG2 HG21 sing N N 131 ILE CG2 HG22 sing N N 132 ILE CG2 HG23 sing N N 133 ILE CD1 HD11 sing N N 134 ILE CD1 HD12 sing N N 135 ILE CD1 HD13 sing N N 136 ILE OXT HXT sing N N 137 LEU N CA sing N N 138 LEU N H sing N N 139 LEU N H2 sing N N 140 LEU CA C sing N N 141 LEU CA CB sing N N 142 LEU CA HA sing N N 143 LEU C O doub N N 144 LEU C OXT sing N N 145 LEU CB CG sing N N 146 LEU CB HB2 sing N N 147 LEU CB HB3 sing N N 148 LEU CG CD1 sing N N 149 LEU CG CD2 sing N N 150 LEU CG HG sing N N 151 LEU CD1 HD11 sing N N 152 LEU CD1 HD12 sing N N 153 LEU CD1 HD13 sing N N 154 LEU CD2 HD21 sing N N 155 LEU CD2 HD22 sing N N 156 LEU CD2 HD23 sing N N 157 LEU OXT HXT sing N N 158 LYS N CA sing N N 159 LYS N H sing N N 160 LYS N H2 sing N N 161 LYS CA C sing N N 162 LYS CA CB sing N N 163 LYS CA HA sing N N 164 LYS C O doub N N 165 LYS C OXT sing N N 166 LYS CB CG sing N N 167 LYS CB HB2 sing N N 168 LYS CB HB3 sing N N 169 LYS CG CD sing N N 170 LYS CG HG2 sing N N 171 LYS CG HG3 sing N N 172 LYS CD CE sing N N 173 LYS CD HD2 sing N N 174 LYS CD HD3 sing N N 175 LYS CE NZ sing N N 176 LYS CE HE2 sing N N 177 LYS CE HE3 sing N N 178 LYS NZ HZ1 sing N N 179 LYS NZ HZ2 sing N N 180 LYS NZ HZ3 sing N N 181 LYS OXT HXT sing N N 182 MET N CA sing N N 183 MET N H sing N N 184 MET N H2 sing N N 185 MET CA C sing N N 186 MET CA CB sing N N 187 MET CA HA sing N N 188 MET C O doub N N 189 MET C OXT sing N N 190 MET CB CG sing N N 191 MET CB HB2 sing N N 192 MET CB HB3 sing N N 193 MET CG SD sing N N 194 MET CG HG2 sing N N 195 MET CG HG3 sing N N 196 MET SD CE sing N N 197 MET CE HE1 sing N N 198 MET CE HE2 sing N N 199 MET CE HE3 sing N N 200 MET OXT HXT sing N N 201 PHE N CA sing N N 202 PHE N H sing N N 203 PHE N H2 sing N N 204 PHE CA C sing N N 205 PHE CA CB sing N N 206 PHE CA HA sing N N 207 PHE C O doub N N 208 PHE C OXT sing N N 209 PHE CB CG sing N N 210 PHE CB HB2 sing N N 211 PHE CB HB3 sing N N 212 PHE CG CD1 doub Y N 213 PHE CG CD2 sing Y N 214 PHE CD1 CE1 sing Y N 215 PHE CD1 HD1 sing N N 216 PHE CD2 CE2 doub Y N 217 PHE CD2 HD2 sing N N 218 PHE CE1 CZ doub Y N 219 PHE CE1 HE1 sing N N 220 PHE CE2 CZ sing Y N 221 PHE CE2 HE2 sing N N 222 PHE CZ HZ sing N N 223 PHE OXT HXT sing N N 224 PRO N CA sing N N 225 PRO N CD sing N N 226 PRO N H sing N N 227 PRO CA C sing N N 228 PRO CA CB sing N N 229 PRO CA HA sing N N 230 PRO C O doub N N 231 PRO C OXT sing N N 232 PRO CB CG sing N N 233 PRO CB HB2 sing N N 234 PRO CB HB3 sing N N 235 PRO CG CD sing N N 236 PRO CG HG2 sing N N 237 PRO CG HG3 sing N N 238 PRO CD HD2 sing N N 239 PRO CD HD3 sing N N 240 PRO OXT HXT sing N N 241 SER N CA sing N N 242 SER N H sing N N 243 SER N H2 sing N N 244 SER CA C sing N N 245 SER CA CB sing N N 246 SER CA HA sing N N 247 SER C O doub N N 248 SER C OXT sing N N 249 SER CB OG sing N N 250 SER CB HB2 sing N N 251 SER CB HB3 sing N N 252 SER OG HG sing N N 253 SER OXT HXT sing N N 254 THR N CA sing N N 255 THR N H sing N N 256 THR N H2 sing N N 257 THR CA C sing N N 258 THR CA CB sing N N 259 THR CA HA sing N N 260 THR C O doub N N 261 THR C OXT sing N N 262 THR CB OG1 sing N N 263 THR CB CG2 sing N N 264 THR CB HB sing N N 265 THR OG1 HG1 sing N N 266 THR CG2 HG21 sing N N 267 THR CG2 HG22 sing N N 268 THR CG2 HG23 sing N N 269 THR OXT HXT sing N N 270 TRP N CA sing N N 271 TRP N H sing N N 272 TRP N H2 sing N N 273 TRP CA C sing N N 274 TRP CA CB sing N N 275 TRP CA HA sing N N 276 TRP C O doub N N 277 TRP C OXT sing N N 278 TRP CB CG sing N N 279 TRP CB HB2 sing N N 280 TRP CB HB3 sing N N 281 TRP CG CD1 doub Y N 282 TRP CG CD2 sing Y N 283 TRP CD1 NE1 sing Y N 284 TRP CD1 HD1 sing N N 285 TRP CD2 CE2 doub Y N 286 TRP CD2 CE3 sing Y N 287 TRP NE1 CE2 sing Y N 288 TRP NE1 HE1 sing N N 289 TRP CE2 CZ2 sing Y N 290 TRP CE3 CZ3 doub Y N 291 TRP CE3 HE3 sing N N 292 TRP CZ2 CH2 doub Y N 293 TRP CZ2 HZ2 sing N N 294 TRP CZ3 CH2 sing Y N 295 TRP CZ3 HZ3 sing N N 296 TRP CH2 HH2 sing N N 297 TRP OXT HXT sing N N 298 TYR N CA sing N N 299 TYR N H sing N N 300 TYR N H2 sing N N 301 TYR CA C sing N N 302 TYR CA CB sing N N 303 TYR CA HA sing N N 304 TYR C O doub N N 305 TYR C OXT sing N N 306 TYR CB CG sing N N 307 TYR CB HB2 sing N N 308 TYR CB HB3 sing N N 309 TYR CG CD1 doub Y N 310 TYR CG CD2 sing Y N 311 TYR CD1 CE1 sing Y N 312 TYR CD1 HD1 sing N N 313 TYR CD2 CE2 doub Y N 314 TYR CD2 HD2 sing N N 315 TYR CE1 CZ doub Y N 316 TYR CE1 HE1 sing N N 317 TYR CE2 CZ sing Y N 318 TYR CE2 HE2 sing N N 319 TYR CZ OH sing N N 320 TYR OH HH sing N N 321 TYR OXT HXT sing N N 322 VAL N CA sing N N 323 VAL N H sing N N 324 VAL N H2 sing N N 325 VAL CA C sing N N 326 VAL CA CB sing N N 327 VAL CA HA sing N N 328 VAL C O doub N N 329 VAL C OXT sing N N 330 VAL CB CG1 sing N N 331 VAL CB CG2 sing N N 332 VAL CB HB sing N N 333 VAL CG1 HG11 sing N N 334 VAL CG1 HG12 sing N N 335 VAL CG1 HG13 sing N N 336 VAL CG2 HG21 sing N N 337 VAL CG2 HG22 sing N N 338 VAL CG2 HG23 sing N N 339 VAL OXT HXT sing N N 340 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 700 # _atom_sites.entry_id 1WJN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_