data_1WJX # _entry.id 1WJX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1WJX RCSB RCSB023657 WWPDB D_1000023657 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ttk003000801.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WJX _pdbx_database_status.recvd_initial_deposition_date 2004-05-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bessho, Y.' 1 'Shibata, R.' 2 'Shirouzu, M.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Structural basis for functional mimicry of long-variable-arm tRNA by transfer-messenger RNA.' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 104 _citation.page_first 8293 _citation.page_last 8298 _citation.year 2007 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17488812 _citation.pdbx_database_id_DOI 10.1073/pnas.0700402104 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bessho, Y.' 1 primary 'Shibata, R.' 2 primary 'Sekine, S.' 3 primary 'Murayama, K.' 4 primary 'Higashijima, K.' 5 primary 'Hori-Takemoto, C.' 6 primary 'Shirouzu, M.' 7 primary 'Kuramitsu, S.' 8 primary 'Yokoyama, S.' 9 # _cell.entry_id 1WJX _cell.length_a 74.676 _cell.length_b 74.676 _cell.length_c 47.038 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1WJX _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SsrA-binding protein' 14046.285 1 ? ? 'Residues 1-122' ? 2 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 3 water nat water 18.015 76 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Small Protein B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIAPYEKGSYANVDPRRKRKLLL HKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLARGK ; _entity_poly.pdbx_seq_one_letter_code_can ;APVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIAPYEKGSYANVDPRRKRKLLL HKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLARGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003000801.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 VAL n 1 4 LEU n 1 5 GLU n 1 6 ASN n 1 7 ARG n 1 8 ARG n 1 9 ALA n 1 10 ARG n 1 11 HIS n 1 12 ASP n 1 13 TYR n 1 14 GLU n 1 15 ILE n 1 16 LEU n 1 17 GLU n 1 18 THR n 1 19 TYR n 1 20 GLU n 1 21 ALA n 1 22 GLY n 1 23 ILE n 1 24 ALA n 1 25 LEU n 1 26 LYS n 1 27 GLY n 1 28 THR n 1 29 GLU n 1 30 VAL n 1 31 LYS n 1 32 SER n 1 33 LEU n 1 34 ARG n 1 35 ALA n 1 36 GLY n 1 37 LYS n 1 38 VAL n 1 39 ASP n 1 40 PHE n 1 41 THR n 1 42 GLY n 1 43 SER n 1 44 PHE n 1 45 ALA n 1 46 ARG n 1 47 PHE n 1 48 GLU n 1 49 ASP n 1 50 GLY n 1 51 GLU n 1 52 LEU n 1 53 TYR n 1 54 LEU n 1 55 GLU n 1 56 ASN n 1 57 LEU n 1 58 TYR n 1 59 ILE n 1 60 ALA n 1 61 PRO n 1 62 TYR n 1 63 GLU n 1 64 LYS n 1 65 GLY n 1 66 SER n 1 67 TYR n 1 68 ALA n 1 69 ASN n 1 70 VAL n 1 71 ASP n 1 72 PRO n 1 73 ARG n 1 74 ARG n 1 75 LYS n 1 76 ARG n 1 77 LYS n 1 78 LEU n 1 79 LEU n 1 80 LEU n 1 81 HIS n 1 82 LYS n 1 83 HIS n 1 84 GLU n 1 85 LEU n 1 86 ARG n 1 87 ARG n 1 88 LEU n 1 89 LEU n 1 90 GLY n 1 91 LYS n 1 92 VAL n 1 93 GLU n 1 94 GLN n 1 95 LYS n 1 96 GLY n 1 97 LEU n 1 98 THR n 1 99 LEU n 1 100 VAL n 1 101 PRO n 1 102 LEU n 1 103 LYS n 1 104 ILE n 1 105 TYR n 1 106 PHE n 1 107 ASN n 1 108 GLU n 1 109 ARG n 1 110 GLY n 1 111 TYR n 1 112 ALA n 1 113 LYS n 1 114 VAL n 1 115 LEU n 1 116 LEU n 1 117 GLY n 1 118 LEU n 1 119 ALA n 1 120 ARG n 1 121 GLY n 1 122 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TT0801 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SSRP_THET8 _struct_ref.pdbx_db_accession Q8RR57 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APVLENRRARHDYEILETYEAGIALKGTEVKSLRAGKVDFTGSFARFEDGELYLENLYIAPYEKGSYANVDPRRKRKLLL HKHELRRLLGKVEQKGLTLVPLKIYFNERGYAKVLLGLARGK ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WJX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8RR57 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 122 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1WJX _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.70 _exptl_crystal.density_percent_sol 54.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.pdbx_collection_date 2002-11-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.000 # _reflns.entry_id 1WJX _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.70 _reflns.number_obs 16516 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.083 _reflns.pdbx_netI_over_sigmaI 35.9027 _reflns.B_iso_Wilson_estimate 19.9 _reflns.pdbx_redundancy 10.9662 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.76 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.485 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1WJX _refine.ls_number_reflns_obs 16493 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1092761.33 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 1.70 _refine.ls_percent_reflns_obs 99.8 _refine.ls_R_factor_obs 0.224 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.224 _refine.ls_R_factor_R_free 0.229 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 808 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 27.3 _refine.aniso_B[1][1] 2.27 _refine.aniso_B[2][2] 2.27 _refine.aniso_B[3][3] -4.53 _refine.aniso_B[1][2] 3.22 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.395547 _refine.solvent_model_param_bsol 43.8813 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'Thermus SmpB derivative (L88M-I104M).' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1WJX _refine_analyze.Luzzati_coordinate_error_obs 0.21 _refine_analyze.Luzzati_sigma_a_obs 0.09 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.23 _refine_analyze.Luzzati_sigma_a_free 0.15 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 916 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 76 _refine_hist.number_atoms_total 993 _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.004 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.5 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.64 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.59 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.66 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.46 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.97 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.70 _refine_ls_shell.d_res_low 1.81 _refine_ls_shell.number_reflns_R_work 2529 _refine_ls_shell.R_factor_R_work 0.238 _refine_ls_shell.percent_reflns_obs 97.3 _refine_ls_shell.R_factor_R_free 0.296 _refine_ls_shell.R_factor_R_free_error 0.027 _refine_ls_shell.percent_reflns_R_free 4.6 _refine_ls_shell.number_reflns_R_free 123 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1WJX _struct.title 'Crystal sturucture of TT0801 from Thermus thermophilus' _struct.pdbx_descriptor 'SsrA-binding protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WJX _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RNA binding protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 6 ? ASP A 12 ? ASN A 6 ASP A 12 1 ? 7 HELX_P HELX_P2 2 THR A 28 ? ALA A 35 ? THR A 28 ALA A 35 1 ? 8 HELX_P HELX_P3 3 HIS A 81 ? LEU A 89 ? HIS A 81 LEU A 89 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B K . K ? ? ? 1_555 A HIS 11 ND1 ? ? A K 151 A HIS 11 1_555 ? ? ? ? ? ? ? 2.419 ? metalc2 metalc ? ? B K . K ? ? ? 1_555 A ASP 12 OD1 ? ? A K 151 A ASP 12 1_555 ? ? ? ? ? ? ? 2.239 ? metalc3 metalc ? ? B K . K ? ? ? 1_555 A ASP 12 OD2 ? ? A K 151 A ASP 12 1_555 ? ? ? ? ? ? ? 2.857 ? metalc4 metalc ? ? B K . K ? ? ? 1_555 A HIS 81 ND1 ? ? A K 151 A HIS 81 4_654 ? ? ? ? ? ? ? 2.220 ? metalc5 metalc ? ? B K . K ? ? ? 1_555 A HIS 83 NE2 ? ? A K 151 A HIS 83 4_654 ? ? ? ? ? ? ? 2.142 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 4 ? GLU A 5 ? LEU A 4 GLU A 5 A 2 LEU A 97 ? PHE A 106 ? LEU A 97 PHE A 106 A 3 ALA A 112 ? GLY A 121 ? ALA A 112 GLY A 121 A 4 TYR A 13 ? ILE A 23 ? TYR A 13 ILE A 23 A 5 ARG A 76 ? LEU A 79 ? ARG A 76 LEU A 79 A 6 GLU A 51 ? GLU A 55 ? GLU A 51 GLU A 55 A 7 PHE A 44 ? GLU A 48 ? PHE A 44 GLU A 48 B 1 VAL A 38 ? ASP A 39 ? VAL A 38 ASP A 39 B 2 TYR A 58 ? ILE A 59 ? TYR A 58 ILE A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 4 ? N LEU A 4 O ILE A 104 ? O ILE A 104 A 2 3 N LEU A 102 ? N LEU A 102 O LEU A 115 ? O LEU A 115 A 3 4 O LEU A 116 ? O LEU A 116 N TYR A 19 ? N TYR A 19 A 4 5 N GLY A 22 ? N GLY A 22 O LEU A 79 ? O LEU A 79 A 5 6 O ARG A 76 ? O ARG A 76 N LEU A 54 ? N LEU A 54 A 6 7 O GLU A 55 ? O GLU A 55 N PHE A 44 ? N PHE A 44 B 1 2 N ASP A 39 ? N ASP A 39 O TYR A 58 ? O TYR A 58 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE K A 151' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 11 ? HIS A 11 . ? 1_555 ? 2 AC1 4 ASP A 12 ? ASP A 12 . ? 1_555 ? 3 AC1 4 HIS A 81 ? HIS A 81 . ? 4_654 ? 4 AC1 4 HIS A 83 ? HIS A 83 . ? 4_654 ? # _database_PDB_matrix.entry_id 1WJX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WJX _atom_sites.fract_transf_matrix[1][1] 0.013391 _atom_sites.fract_transf_matrix[1][2] 0.007731 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015463 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021259 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C K N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 TYR 62 62 ? ? ? A . n A 1 63 GLU 63 63 ? ? ? A . n A 1 64 LYS 64 64 ? ? ? A . n A 1 65 GLY 65 65 ? ? ? A . n A 1 66 SER 66 66 ? ? ? A . n A 1 67 TYR 67 67 ? ? ? A . n A 1 68 ALA 68 68 ? ? ? A . n A 1 69 ASN 69 69 ? ? ? A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 LYS 122 122 122 LYS LYS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 K 1 151 151 K K A . C 3 HOH 1 201 201 HOH HOH A . C 3 HOH 2 202 202 HOH HOH A . C 3 HOH 3 203 203 HOH HOH A . C 3 HOH 4 204 204 HOH HOH A . C 3 HOH 5 205 205 HOH HOH A . C 3 HOH 6 206 206 HOH HOH A . C 3 HOH 7 207 207 HOH HOH A . C 3 HOH 8 208 208 HOH HOH A . C 3 HOH 9 209 209 HOH HOH A . C 3 HOH 10 210 210 HOH HOH A . C 3 HOH 11 211 211 HOH HOH A . C 3 HOH 12 212 212 HOH HOH A . C 3 HOH 13 213 213 HOH HOH A . C 3 HOH 14 214 214 HOH HOH A . C 3 HOH 15 215 215 HOH HOH A . C 3 HOH 16 216 216 HOH HOH A . C 3 HOH 17 217 217 HOH HOH A . C 3 HOH 18 218 218 HOH HOH A . C 3 HOH 19 219 219 HOH HOH A . C 3 HOH 20 220 220 HOH HOH A . C 3 HOH 21 221 221 HOH HOH A . C 3 HOH 22 222 222 HOH HOH A . C 3 HOH 23 223 223 HOH HOH A . C 3 HOH 24 224 224 HOH HOH A . C 3 HOH 25 225 225 HOH HOH A . C 3 HOH 26 226 226 HOH HOH A . C 3 HOH 27 227 227 HOH HOH A . C 3 HOH 28 228 228 HOH HOH A . C 3 HOH 29 229 229 HOH HOH A . C 3 HOH 30 230 230 HOH HOH A . C 3 HOH 31 231 231 HOH HOH A . C 3 HOH 32 232 232 HOH HOH A . C 3 HOH 33 233 233 HOH HOH A . C 3 HOH 34 234 234 HOH HOH A . C 3 HOH 35 235 235 HOH HOH A . C 3 HOH 36 236 236 HOH HOH A . C 3 HOH 37 237 237 HOH HOH A . C 3 HOH 38 238 238 HOH HOH A . C 3 HOH 39 239 239 HOH HOH A . C 3 HOH 40 240 240 HOH HOH A . C 3 HOH 41 241 241 HOH HOH A . C 3 HOH 42 242 242 HOH HOH A . C 3 HOH 43 243 243 HOH HOH A . C 3 HOH 44 244 244 HOH HOH A . C 3 HOH 45 245 245 HOH HOH A . C 3 HOH 46 246 246 HOH HOH A . C 3 HOH 47 247 247 HOH HOH A . C 3 HOH 48 248 248 HOH HOH A . C 3 HOH 49 249 249 HOH HOH A . C 3 HOH 50 251 251 HOH HOH A . C 3 HOH 51 252 252 HOH HOH A . C 3 HOH 52 253 253 HOH HOH A . C 3 HOH 53 254 254 HOH HOH A . C 3 HOH 54 255 255 HOH HOH A . C 3 HOH 55 256 256 HOH HOH A . C 3 HOH 56 257 257 HOH HOH A . C 3 HOH 57 258 258 HOH HOH A . C 3 HOH 58 259 259 HOH HOH A . C 3 HOH 59 260 260 HOH HOH A . C 3 HOH 60 261 261 HOH HOH A . C 3 HOH 61 262 262 HOH HOH A . C 3 HOH 62 263 263 HOH HOH A . C 3 HOH 63 264 264 HOH HOH A . C 3 HOH 64 265 265 HOH HOH A . C 3 HOH 65 266 266 HOH HOH A . C 3 HOH 66 267 267 HOH HOH A . C 3 HOH 67 268 268 HOH HOH A . C 3 HOH 68 269 269 HOH HOH A . C 3 HOH 69 270 270 HOH HOH A . C 3 HOH 70 272 272 HOH HOH A . C 3 HOH 71 273 273 HOH HOH A . C 3 HOH 72 274 274 HOH HOH A . C 3 HOH 73 275 275 HOH HOH A . C 3 HOH 74 277 277 HOH HOH A . C 3 HOH 75 282 282 HOH HOH A . C 3 HOH 76 283 283 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 11 ? A HIS 11 ? 1_555 K ? B K . ? A K 151 ? 1_555 OD1 ? A ASP 12 ? A ASP 12 ? 1_555 88.8 ? 2 ND1 ? A HIS 11 ? A HIS 11 ? 1_555 K ? B K . ? A K 151 ? 1_555 OD2 ? A ASP 12 ? A ASP 12 ? 1_555 129.9 ? 3 OD1 ? A ASP 12 ? A ASP 12 ? 1_555 K ? B K . ? A K 151 ? 1_555 OD2 ? A ASP 12 ? A ASP 12 ? 1_555 49.3 ? 4 ND1 ? A HIS 11 ? A HIS 11 ? 1_555 K ? B K . ? A K 151 ? 1_555 ND1 ? A HIS 81 ? A HIS 81 ? 4_654 115.3 ? 5 OD1 ? A ASP 12 ? A ASP 12 ? 1_555 K ? B K . ? A K 151 ? 1_555 ND1 ? A HIS 81 ? A HIS 81 ? 4_654 90.7 ? 6 OD2 ? A ASP 12 ? A ASP 12 ? 1_555 K ? B K . ? A K 151 ? 1_555 ND1 ? A HIS 81 ? A HIS 81 ? 4_654 94.0 ? 7 ND1 ? A HIS 11 ? A HIS 11 ? 1_555 K ? B K . ? A K 151 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 4_654 110.0 ? 8 OD1 ? A ASP 12 ? A ASP 12 ? 1_555 K ? B K . ? A K 151 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 4_654 136.3 ? 9 OD2 ? A ASP 12 ? A ASP 12 ? 1_555 K ? B K . ? A K 151 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 4_654 91.6 ? 10 ND1 ? A HIS 81 ? A HIS 81 ? 4_654 K ? B K . ? A K 151 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 4_654 113.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-29 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 MOLREP phasing . ? 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 16 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -92.85 _pdbx_validate_torsion.psi -129.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A TYR 62 ? A TYR 62 4 1 Y 1 A GLU 63 ? A GLU 63 5 1 Y 1 A LYS 64 ? A LYS 64 6 1 Y 1 A GLY 65 ? A GLY 65 7 1 Y 1 A SER 66 ? A SER 66 8 1 Y 1 A TYR 67 ? A TYR 67 9 1 Y 1 A ALA 68 ? A ALA 68 10 1 Y 1 A ASN 69 ? A ASN 69 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'POTASSIUM ION' K 3 water HOH #