data_1WK2 # _entry.id 1WK2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1WK2 RCSB RCSB023662 WWPDB D_1000023662 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ttk003001768.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WK2 _pdbx_database_status.recvd_initial_deposition_date 2004-05-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Agari, Y.' 1 'Yokoyama, S.' 2 'Kuramitsu, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Crystal structure of a hypothetical protein from thermus thermophilus HB8' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Agari, Y.' 1 primary 'Yokoyama, S.' 2 primary 'Kuramitsu, S.' 3 # _cell.entry_id 1WK2 _cell.length_a 52.583 _cell.length_b 55.846 _cell.length_c 43.186 _cell.angle_alpha 90.00 _cell.angle_beta 96.60 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WK2 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HYPOTHETICAL PROTEIN' 14145.099 1 ? ? ? ? 2 water nat water 18.015 45 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGRLIGQADLVGVEGPFSVEELLAHQEKHLAEEA FLRAYAKDEPLYAWVLENAFRYEKPLHVPRRPGRV(MSE)FVDLSEVRW ; _entity_poly.pdbx_seq_one_letter_code_can ;MERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGRLIGQADLVGVEGPFSVEELLAHQEKHLAEEAFLRA YAKDEPLYAWVLENAFRYEKPLHVPRRPGRVMFVDLSEVRW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003001768.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLU n 1 3 ARG n 1 4 PRO n 1 5 LYS n 1 6 LEU n 1 7 GLY n 1 8 LEU n 1 9 ILE n 1 10 VAL n 1 11 ARG n 1 12 GLU n 1 13 PRO n 1 14 TYR n 1 15 ALA n 1 16 SER n 1 17 LEU n 1 18 ILE n 1 19 VAL n 1 20 ASP n 1 21 GLY n 1 22 ARG n 1 23 LYS n 1 24 VAL n 1 25 TRP n 1 26 GLU n 1 27 ILE n 1 28 ARG n 1 29 ARG n 1 30 ARG n 1 31 LYS n 1 32 THR n 1 33 ARG n 1 34 HIS n 1 35 ARG n 1 36 GLY n 1 37 PRO n 1 38 LEU n 1 39 GLY n 1 40 ILE n 1 41 VAL n 1 42 SER n 1 43 GLY n 1 44 GLY n 1 45 ARG n 1 46 LEU n 1 47 ILE n 1 48 GLY n 1 49 GLN n 1 50 ALA n 1 51 ASP n 1 52 LEU n 1 53 VAL n 1 54 GLY n 1 55 VAL n 1 56 GLU n 1 57 GLY n 1 58 PRO n 1 59 PHE n 1 60 SER n 1 61 VAL n 1 62 GLU n 1 63 GLU n 1 64 LEU n 1 65 LEU n 1 66 ALA n 1 67 HIS n 1 68 GLN n 1 69 GLU n 1 70 LYS n 1 71 HIS n 1 72 LEU n 1 73 ALA n 1 74 GLU n 1 75 GLU n 1 76 ALA n 1 77 PHE n 1 78 LEU n 1 79 ARG n 1 80 ALA n 1 81 TYR n 1 82 ALA n 1 83 LYS n 1 84 ASP n 1 85 GLU n 1 86 PRO n 1 87 LEU n 1 88 TYR n 1 89 ALA n 1 90 TRP n 1 91 VAL n 1 92 LEU n 1 93 GLU n 1 94 ASN n 1 95 ALA n 1 96 PHE n 1 97 ARG n 1 98 TYR n 1 99 GLU n 1 100 LYS n 1 101 PRO n 1 102 LEU n 1 103 HIS n 1 104 VAL n 1 105 PRO n 1 106 ARG n 1 107 ARG n 1 108 PRO n 1 109 GLY n 1 110 ARG n 1 111 VAL n 1 112 MSE n 1 113 PHE n 1 114 VAL n 1 115 ASP n 1 116 LEU n 1 117 SER n 1 118 GLU n 1 119 VAL n 1 120 ARG n 1 121 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5SM30_THET8 _struct_ref.pdbx_db_accession Q5SM30 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WK2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 121 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5SM30 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 121 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1WK2 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.2 _exptl_crystal.density_percent_sol 44.8 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.7 _exptl_crystal_grow.pdbx_details '23% PEG3350, pH 6.7, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 ? ? 1 3 ? ? 1 1,2,3 ? ? 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.pdbx_collection_date 2004-04-17 _diffrn_detector.details ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M 'Si Double Crystal' MAD x-ray 2 1 M 'Si Double Crystal' MAD x-ray 3 1 M 'Si Double Crystal' MAD x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97913 1.0 2 0.9 1.0 3 0.97942 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97913, 0.9, 0.97942' # _reflns.entry_id 1WK2 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 43 _reflns.d_resolution_high 1.9 _reflns.number_obs ? _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 30.1 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1,2,3 # _refine.entry_id 1WK2 _refine.ls_number_reflns_obs 4268 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F .0 _refine.pdbx_data_cutoff_high_absF 1159702.07 _refine.pdbx_data_cutoff_low_absF .000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.78 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 97.6 _refine.ls_R_factor_obs 0.344 _refine.ls_R_factor_all 0.336 _refine.ls_R_factor_R_work 0.327 _refine.ls_R_factor_R_free 0.389 _refine.ls_R_factor_R_free_error .018 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.6 _refine.ls_number_reflns_R_free 451 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 26.2 _refine.aniso_B[1][1] -9.01 _refine.aniso_B[2][2] 11.81 _refine.aniso_B[3][3] -2.80 _refine.aniso_B[1][2] .00 _refine.aniso_B[1][3] 1.27 _refine.aniso_B[2][3] .00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol .443893 _refine.solvent_model_param_bsol 58.0321 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'BULK SOLVENT MODEL USED' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1WK2 _refine_analyze.Luzzati_coordinate_error_obs .48 _refine_analyze.Luzzati_sigma_a_obs .33 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free .56 _refine_analyze.Luzzati_sigma_a_free .52 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 683 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 45 _refine_hist.number_atoms_total 728 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 29.78 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d .008 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 25.7 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.90 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it .00 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it .00 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it .00 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it .00 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.50 _refine_ls_shell.d_res_low 2.66 _refine_ls_shell.number_reflns_R_work 650 _refine_ls_shell.R_factor_R_work 0.373 _refine_ls_shell.percent_reflns_obs 99.9 _refine_ls_shell.R_factor_R_free 0.463 _refine_ls_shell.R_factor_R_free_error .053 _refine_ls_shell.percent_reflns_R_free 10.6 _refine_ls_shell.number_reflns_R_free 77 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1WK2 _struct.title 'Crystal structure of a hypothetical protein from thermus thermophilus HB8' _struct.pdbx_descriptor 'HYPOTHETICAL PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WK2 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 20 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 13 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 20 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A GLU 2 N ? ? A MSE 1 A GLU 2 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale ? ? A MSE 112 C ? ? ? 1_555 A PHE 113 N ? ? A MSE 112 A PHE 113 1_555 ? ? ? ? ? ? ? 1.324 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 12 A . ? GLU 12 A PRO 13 A ? PRO 13 A 1 0.21 2 VAL 104 A . ? VAL 104 A PRO 105 A ? PRO 105 A 1 -0.02 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 7 ? ILE A 9 ? GLY A 7 ILE A 9 A 2 GLY A 36 ? SER A 42 ? GLY A 36 SER A 42 A 3 ARG A 45 ? GLY A 54 ? ARG A 45 GLY A 54 A 4 TYR A 88 ? HIS A 103 ? TYR A 88 HIS A 103 A 5 TRP A 25 ? ARG A 28 ? TRP A 25 ARG A 28 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 8 ? N LEU A 8 O GLY A 39 ? O GLY A 39 A 2 3 N GLY A 36 ? N GLY A 36 O LEU A 52 ? O LEU A 52 A 3 4 N LEU A 46 ? N LEU A 46 O LEU A 102 ? O LEU A 102 A 4 5 O TYR A 88 ? O TYR A 88 N ARG A 28 ? N ARG A 28 # _database_PDB_matrix.entry_id 1WK2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] .000000 _database_PDB_matrix.origx[1][3] .000000 _database_PDB_matrix.origx[2][1] .000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] .000000 _database_PDB_matrix.origx[3][1] .000000 _database_PDB_matrix.origx[3][2] .000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] .00000 _database_PDB_matrix.origx_vector[2] .00000 _database_PDB_matrix.origx_vector[3] .00000 # _atom_sites.entry_id 1WK2 _atom_sites.fract_transf_matrix[1][1] .019018 _atom_sites.fract_transf_matrix[1][2] .000000 _atom_sites.fract_transf_matrix[1][3] .002200 _atom_sites.fract_transf_matrix[2][1] .000000 _atom_sites.fract_transf_matrix[2][2] .017906 _atom_sites.fract_transf_matrix[2][3] .000000 _atom_sites.fract_transf_matrix[3][1] .000000 _atom_sites.fract_transf_matrix[3][2] .000000 _atom_sites.fract_transf_matrix[3][3] .023310 _atom_sites.fract_transf_vector[1] .00000 _atom_sites.fract_transf_vector[2] .00000 _atom_sites.fract_transf_vector[3] .00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 ? ? ? A . n A 1 57 GLY 57 57 ? ? ? A . n A 1 58 PRO 58 58 ? ? ? A . n A 1 59 PHE 59 59 ? ? ? A . n A 1 60 SER 60 60 ? ? ? A . n A 1 61 VAL 61 61 ? ? ? A . n A 1 62 GLU 62 62 ? ? ? A . n A 1 63 GLU 63 63 ? ? ? A . n A 1 64 LEU 64 64 ? ? ? A . n A 1 65 LEU 65 65 ? ? ? A . n A 1 66 ALA 66 66 ? ? ? A . n A 1 67 HIS 67 67 ? ? ? A . n A 1 68 GLN 68 68 ? ? ? A . n A 1 69 GLU 69 69 ? ? ? A . n A 1 70 LYS 70 70 ? ? ? A . n A 1 71 HIS 71 71 ? ? ? A . n A 1 72 LEU 72 72 ? ? ? A . n A 1 73 ALA 73 73 ? ? ? A . n A 1 74 GLU 74 74 ? ? ? A . n A 1 75 GLU 75 75 ? ? ? A . n A 1 76 ALA 76 76 ? ? ? A . n A 1 77 PHE 77 77 ? ? ? A . n A 1 78 LEU 78 78 ? ? ? A . n A 1 79 ARG 79 79 ? ? ? A . n A 1 80 ALA 80 80 ? ? ? A . n A 1 81 TYR 81 81 ? ? ? A . n A 1 82 ALA 82 82 ? ? ? A . n A 1 83 LYS 83 83 ? ? ? A . n A 1 84 ASP 84 84 ? ? ? A . n A 1 85 GLU 85 85 ? ? ? A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ARG 106 106 ? ? ? A . n A 1 107 ARG 107 107 ? ? ? A . n A 1 108 PRO 108 108 ? ? ? A . n A 1 109 GLY 109 109 ? ? ? A . n A 1 110 ARG 110 110 ? ? ? A . n A 1 111 VAL 111 111 ? ? ? A . n A 1 112 MSE 112 112 112 MSE MSE A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 TRP 121 121 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 122 1 HOH HOH A . B 2 HOH 2 123 2 HOH HOH A . B 2 HOH 3 124 3 HOH HOH A . B 2 HOH 4 125 4 HOH HOH A . B 2 HOH 5 126 5 HOH HOH A . B 2 HOH 6 127 6 HOH HOH A . B 2 HOH 7 128 7 HOH HOH A . B 2 HOH 8 129 8 HOH HOH A . B 2 HOH 9 130 9 HOH HOH A . B 2 HOH 10 131 10 HOH HOH A . B 2 HOH 11 132 11 HOH HOH A . B 2 HOH 12 133 12 HOH HOH A . B 2 HOH 13 134 13 HOH HOH A . B 2 HOH 14 135 14 HOH HOH A . B 2 HOH 15 136 15 HOH HOH A . B 2 HOH 16 137 16 HOH HOH A . B 2 HOH 17 138 17 HOH HOH A . B 2 HOH 18 139 18 HOH HOH A . B 2 HOH 19 140 19 HOH HOH A . B 2 HOH 20 141 20 HOH HOH A . B 2 HOH 21 142 21 HOH HOH A . B 2 HOH 22 143 22 HOH HOH A . B 2 HOH 23 144 23 HOH HOH A . B 2 HOH 24 145 24 HOH HOH A . B 2 HOH 25 146 25 HOH HOH A . B 2 HOH 26 147 26 HOH HOH A . B 2 HOH 27 148 27 HOH HOH A . B 2 HOH 28 149 28 HOH HOH A . B 2 HOH 29 150 29 HOH HOH A . B 2 HOH 30 151 30 HOH HOH A . B 2 HOH 31 152 31 HOH HOH A . B 2 HOH 32 153 32 HOH HOH A . B 2 HOH 33 154 33 HOH HOH A . B 2 HOH 34 155 34 HOH HOH A . B 2 HOH 35 156 35 HOH HOH A . B 2 HOH 36 157 36 HOH HOH A . B 2 HOH 37 158 37 HOH HOH A . B 2 HOH 38 159 38 HOH HOH A . B 2 HOH 39 160 39 HOH HOH A . B 2 HOH 40 161 40 HOH HOH A . B 2 HOH 41 162 41 HOH HOH A . B 2 HOH 42 163 42 HOH HOH A . B 2 HOH 43 164 43 HOH HOH A . B 2 HOH 44 165 44 HOH HOH A . B 2 HOH 45 166 45 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 112 A MSE 112 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 2310 ? 2 MORE -23 ? 2 'SSA (A^2)' 10150 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 52.5830000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-30 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 143 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 143 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_656 _pdbx_validate_symm_contact.dist 1.51 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 2 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 68.45 _pdbx_validate_torsion.psi -123.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 56 ? A GLU 56 2 1 Y 1 A GLY 57 ? A GLY 57 3 1 Y 1 A PRO 58 ? A PRO 58 4 1 Y 1 A PHE 59 ? A PHE 59 5 1 Y 1 A SER 60 ? A SER 60 6 1 Y 1 A VAL 61 ? A VAL 61 7 1 Y 1 A GLU 62 ? A GLU 62 8 1 Y 1 A GLU 63 ? A GLU 63 9 1 Y 1 A LEU 64 ? A LEU 64 10 1 Y 1 A LEU 65 ? A LEU 65 11 1 Y 1 A ALA 66 ? A ALA 66 12 1 Y 1 A HIS 67 ? A HIS 67 13 1 Y 1 A GLN 68 ? A GLN 68 14 1 Y 1 A GLU 69 ? A GLU 69 15 1 Y 1 A LYS 70 ? A LYS 70 16 1 Y 1 A HIS 71 ? A HIS 71 17 1 Y 1 A LEU 72 ? A LEU 72 18 1 Y 1 A ALA 73 ? A ALA 73 19 1 Y 1 A GLU 74 ? A GLU 74 20 1 Y 1 A GLU 75 ? A GLU 75 21 1 Y 1 A ALA 76 ? A ALA 76 22 1 Y 1 A PHE 77 ? A PHE 77 23 1 Y 1 A LEU 78 ? A LEU 78 24 1 Y 1 A ARG 79 ? A ARG 79 25 1 Y 1 A ALA 80 ? A ALA 80 26 1 Y 1 A TYR 81 ? A TYR 81 27 1 Y 1 A ALA 82 ? A ALA 82 28 1 Y 1 A LYS 83 ? A LYS 83 29 1 Y 1 A ASP 84 ? A ASP 84 30 1 Y 1 A GLU 85 ? A GLU 85 31 1 Y 1 A ARG 106 ? A ARG 106 32 1 Y 1 A ARG 107 ? A ARG 107 33 1 Y 1 A PRO 108 ? A PRO 108 34 1 Y 1 A GLY 109 ? A GLY 109 35 1 Y 1 A ARG 110 ? A ARG 110 36 1 Y 1 A VAL 111 ? A VAL 111 37 1 Y 1 A TRP 121 ? A TRP 121 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #