data_1WR3 # _entry.id 1WR3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WR3 pdb_00001wr3 10.2210/pdb1wr3/pdb RCSB RCSB023900 ? ? WWPDB D_1000023900 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1WR4 _pdbx_database_related.details 'the second WW domain of Nedd4-2' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WR3 _pdbx_database_status.recvd_initial_deposition_date 2004-10-11 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kowalski, K.' 1 'Merkel, A.L.' 2 'Booker, G.W.' 3 # _citation.id primary _citation.title 'Solution structures of WW domains of Nedd4-2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kowalski, K.' 1 ? primary 'Merkel, A.L.' 2 ? primary 'Booker, G.W.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ubiquitin-protein ligase Nedd4-2' _entity.formula_weight 4209.597 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'first WW domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSPPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPSL _entity_poly.pdbx_seq_one_letter_code_can GSPPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPSL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 PRO n 1 4 PRO n 1 5 LEU n 1 6 PRO n 1 7 PRO n 1 8 GLY n 1 9 TRP n 1 10 GLU n 1 11 GLU n 1 12 LYS n 1 13 VAL n 1 14 ASP n 1 15 ASN n 1 16 LEU n 1 17 GLY n 1 18 ARG n 1 19 THR n 1 20 TYR n 1 21 TYR n 1 22 VAL n 1 23 ASN n 1 24 HIS n 1 25 ASN n 1 26 ASN n 1 27 ARG n 1 28 SER n 1 29 THR n 1 30 GLN n 1 31 TRP n 1 32 HIS n 1 33 ARG n 1 34 PRO n 1 35 SER n 1 36 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NED4L_MOUSE _struct_ref.pdbx_db_accession Q8CFI0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPSL _struct_ref.pdbx_align_begin 72 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WR3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8CFI0 _struct_ref_seq.db_align_beg 72 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 36 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WR3 GLY A 1 ? UNP Q8CFI0 ? ? 'cloning artifact' 1 1 1 1WR3 SER A 2 ? UNP Q8CFI0 ? ? 'cloning artifact' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 2 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.5mM Nedd4-2 WW1; 100mM NaCl; 25mM phosphate buffer; 90% H2O, 10% D2O' '90% H2O, 10%H2O' 2 '0.5mM Nedd4-2 WW1; 100mM NaCl; 25mM phosphate buffer; 100% D2O' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1WR3 _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1WR3 _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1WR3 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WR3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 1.3 processing 'Delaglio et al' 1 Sparky 3.1 'data analysis' 'Goddard & Kneller' 2 ARIA 1.1 'structure solution' 'Linge et al' 3 CNS 1.1 'structure solution' ? 4 CNS 1.1 refinement ? 5 # _exptl.entry_id 1WR3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WR3 _struct.title 'Solution structure of the first WW domain of Nedd4-2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WR3 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'all-beta, LIGASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 9 ? VAL A 13 ? TRP A 9 VAL A 13 A 2 THR A 19 ? ASN A 23 ? THR A 19 ASN A 23 A 3 THR A 29 ? GLN A 30 ? THR A 29 GLN A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 10 ? N GLU A 10 O VAL A 22 ? O VAL A 22 A 2 3 N TYR A 21 ? N TYR A 21 O GLN A 30 ? O GLN A 30 # _database_PDB_matrix.entry_id 1WR3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WR3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-10-18 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 10 ? ? HE2 A HIS 24 ? ? 1.59 2 14 OE1 A GLU 10 ? ? HZ3 A LYS 12 ? ? 1.59 3 20 OE1 A GLU 10 ? ? HZ1 A LYS 12 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 33 ? ? 67.58 134.38 2 2 ASN A 25 ? ? -84.45 -80.25 3 2 ARG A 27 ? ? 73.37 52.00 4 2 ARG A 33 ? ? 66.69 152.71 5 3 ARG A 33 ? ? 69.21 139.54 6 4 PRO A 4 ? ? -66.22 -90.40 7 4 SER A 35 ? ? -167.50 -59.00 8 5 THR A 19 ? ? -68.82 95.87 9 5 ARG A 33 ? ? 67.84 134.18 10 5 PRO A 34 ? ? -59.70 108.18 11 6 SER A 2 ? ? -159.99 63.66 12 6 ASN A 15 ? ? 169.87 -31.70 13 6 THR A 29 ? ? -106.00 70.94 14 6 ARG A 33 ? ? 67.85 138.76 15 6 PRO A 34 ? ? -77.40 46.02 16 7 SER A 2 ? ? -148.49 -56.68 17 7 ASN A 25 ? ? -109.89 -61.00 18 7 ARG A 33 ? ? 66.88 152.28 19 7 PRO A 34 ? ? -62.67 61.25 20 8 ASN A 15 ? ? 172.45 -46.64 21 8 ASN A 25 ? ? -93.71 -65.61 22 8 THR A 29 ? ? -115.79 74.29 23 8 PRO A 34 ? ? -60.07 99.48 24 9 ASP A 14 ? ? -99.98 -84.29 25 9 ARG A 33 ? ? -34.68 130.22 26 10 PRO A 7 ? ? -57.00 107.26 27 10 THR A 19 ? ? -69.07 96.79 28 10 ASN A 25 ? ? -78.92 -78.60 29 10 THR A 29 ? ? -100.21 69.06 30 10 ARG A 33 ? ? 74.41 133.61 31 10 SER A 35 ? ? -80.73 40.80 32 11 ASN A 15 ? ? -127.80 -52.29 33 11 LEU A 16 ? ? -170.61 71.32 34 11 ARG A 27 ? ? 38.38 51.49 35 11 ARG A 33 ? ? 67.30 144.62 36 11 PRO A 34 ? ? -69.64 62.56 37 11 SER A 35 ? ? -90.54 -140.86 38 12 THR A 29 ? ? -100.36 73.66 39 12 ARG A 33 ? ? 66.49 125.79 40 13 SER A 2 ? ? 61.73 89.55 41 13 PRO A 4 ? ? -57.64 104.61 42 13 THR A 29 ? ? -113.08 71.97 43 13 ARG A 33 ? ? 71.64 127.71 44 14 ARG A 27 ? ? 44.16 76.24 45 14 THR A 29 ? ? -110.12 70.87 46 14 ARG A 33 ? ? 65.93 142.69 47 14 PRO A 34 ? ? -61.97 96.54 48 15 ARG A 33 ? ? 66.55 130.95 49 15 PRO A 34 ? ? -62.34 86.74 50 16 LEU A 16 ? ? 94.94 6.32 51 16 ARG A 33 ? ? 68.30 131.47 52 16 SER A 35 ? ? -142.52 25.84 53 17 THR A 19 ? ? -64.25 99.70 54 17 ASN A 25 ? ? -103.03 -61.24 55 17 THR A 29 ? ? -113.87 75.51 56 17 ARG A 33 ? ? 67.08 153.58 57 18 ASN A 15 ? ? -157.25 -48.23 58 18 ARG A 33 ? ? 67.60 138.45 59 18 PRO A 34 ? ? -54.99 95.42 60 19 PRO A 4 ? ? -65.00 -71.81 61 19 ASN A 25 ? ? -97.27 -70.44 62 19 ARG A 27 ? ? 70.32 34.60 63 19 THR A 29 ? ? -108.50 79.39 64 19 ARG A 33 ? ? 68.92 135.77 65 19 PRO A 34 ? ? -67.32 92.57 66 20 ASP A 14 ? ? -75.88 -112.68 67 20 THR A 29 ? ? -116.04 72.97 68 20 ARG A 33 ? ? 68.43 128.70 69 20 PRO A 34 ? ? -67.88 98.97 #