data_1WT7 # _entry.id 1WT7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WT7 pdb_00001wt7 10.2210/pdb1wt7/pdb RCSB RCSB023971 ? ? WWPDB D_1000023971 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WT7 _pdbx_database_status.recvd_initial_deposition_date 2004-11-16 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal ;M'Barek, S. ; 1 'Chagot, B.' 2 'Andreotti, N.' 3 'Visan, V.' 4 'Mansuelle, P.' 5 'Grissmer, S.' 6 'Marrakchi, M.' 7 'El Ayeb, M.' 8 'Sampieri, F.' 9 'Darbon, H.' 10 'Fajloun, Z.' 11 'De Waard, M.' 12 'Sabatier, J.-M.' 13 # _citation.id primary _citation.title 'Increasing the molecular contacts between maurotoxin and Kv1.2 channel augments ligand affinity.' _citation.journal_abbrev Proteins _citation.journal_volume 60 _citation.page_first 401 _citation.page_last 411 _citation.year 2005 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15971207 _citation.pdbx_database_id_DOI 10.1002/prot.20509 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary ;M'Barek, S. ; 1 ? primary 'Chagot, B.' 2 ? primary 'Andreotti, N.' 3 ? primary 'Visan, V.' 4 ? primary 'Mansuelle, P.' 5 ? primary 'Grissmer, S.' 6 ? primary 'Marrakchi, M.' 7 ? primary 'El Ayeb, M.' 8 ? primary 'Sampieri, F.' 9 ? primary 'Darbon, H.' 10 ? primary 'Fajloun, Z.' 11 ? primary 'De Waard, M.' 12 ? primary 'Sabatier, J.M.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description BuTX-MTX _entity.formula_weight 4434.240 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name butantoxin-maurotoxin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code WCSTCLDLACTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC _entity_poly.pdbx_seq_one_letter_code_can WCSTCLDLACTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TRP n 1 2 CYS n 1 3 SER n 1 4 THR n 1 5 CYS n 1 6 LEU n 1 7 ASP n 1 8 LEU n 1 9 ALA n 1 10 CYS n 1 11 THR n 1 12 GLY n 1 13 SER n 1 14 LYS n 1 15 ASP n 1 16 CYS n 1 17 TYR n 1 18 ALA n 1 19 PRO n 1 20 CYS n 1 21 ARG n 1 22 LYS n 1 23 GLN n 1 24 THR n 1 25 GLY n 1 26 CYS n 1 27 PRO n 1 28 ASN n 1 29 ALA n 1 30 LYS n 1 31 CYS n 1 32 ILE n 1 33 ASN n 1 34 LYS n 1 35 SER n 1 36 CYS n 1 37 LYS n 1 38 CYS n 1 39 TYR n 1 40 GLY n 1 41 CYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;butantoxin-maurotoxin chimera (Butantoxin: toxin from the Brazilian scorpion Tityus serrulatus, maurotoxin: toxin from the scorpion S. maurus palmatus) ; # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP SCK4_TITSE P59936 1 WCSTCLDLA 1 ? 2 UNP SCXM_SCOMA P80719 1 CTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC 3 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1WT7 A 1 ? 9 ? P59936 1 ? 9 ? 1 9 2 2 1WT7 A 10 ? 41 ? P80719 3 ? 34 ? 10 41 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 DQF-COSY 2 2 1 '2D TOCSY' 3 3 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 290 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_ensemble.entry_id 1WT7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.1 processing ? 1 XEASY 1.13 'data analysis' ? 2 ARIA 1.2 'structure solution' ? 3 ARIA 1.2 refinement ? 4 # _exptl.entry_id 1WT7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WT7 _struct.title 'Solution structure of BuTX-MTX: a butantoxin-maurotoxin chimera' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WT7 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Maurotoxin, Butantoxin, Scorpion toxin, K+ channels, molecular contacts, toxin affinity, toxin' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 12 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 12 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 25 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 5 SG ? ? A CYS 2 A CYS 5 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 10 A CYS 31 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 16 A CYS 36 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf4 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 20 A CYS 38 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf5 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 26 A CYS 41 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 29 ? ILE A 32 ? ALA A 29 ILE A 32 A 2 SER A 35 ? CYS A 38 ? SER A 35 CYS A 38 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 32 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 32 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id SER _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 35 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id SER _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 35 # _database_PDB_matrix.entry_id 1WT7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WT7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TRP 1 1 1 TRP TRP A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 CYS 41 41 41 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-30 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 24 _pdbx_validate_close_contact.auth_atom_id_1 HB2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TRP _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLN _pdbx_validate_close_contact.auth_seq_id_2 23 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 6 ? ? -109.49 -71.25 2 1 LEU A 8 ? ? -101.68 43.95 3 1 ALA A 9 ? ? -55.68 83.68 4 2 ALA A 9 ? ? -53.90 81.10 5 2 LYS A 34 ? ? 73.25 -15.07 6 3 THR A 4 ? ? -108.61 -95.28 7 3 LEU A 8 ? ? -89.76 31.30 8 3 ALA A 9 ? ? -55.17 85.41 9 3 ASN A 33 ? ? -53.77 97.96 10 4 ALA A 9 ? ? -56.34 83.82 11 4 ASN A 28 ? ? -58.73 103.96 12 5 THR A 4 ? ? -150.66 37.46 13 5 ALA A 9 ? ? -58.67 79.43 14 5 THR A 11 ? ? -89.50 32.18 15 5 TYR A 39 ? ? -79.62 22.51 16 6 ALA A 9 ? ? -56.44 81.06 17 7 SER A 3 ? ? -77.63 44.76 18 7 THR A 4 ? ? -148.04 -21.31 19 7 ALA A 9 ? ? -57.69 83.34 20 8 ALA A 9 ? ? -49.91 84.13 21 9 THR A 4 ? ? -149.98 39.76 22 9 ALA A 9 ? ? -52.97 81.76 23 9 ASN A 28 ? ? -58.99 105.48 24 10 SER A 3 ? ? -73.36 -70.45 25 10 ALA A 9 ? ? -58.21 81.41 26 10 ASN A 33 ? ? 43.15 17.98 27 10 LYS A 34 ? ? 169.85 -56.43 28 10 TYR A 39 ? ? -79.82 23.21 29 11 ALA A 9 ? ? -54.53 82.59 30 11 ASN A 33 ? ? -19.04 80.99 31 11 LYS A 34 ? ? 157.31 -52.16 32 12 LEU A 8 ? ? -84.37 31.43 33 12 ALA A 9 ? ? -53.84 83.67 34 12 ASN A 33 ? ? -67.31 79.55 35 12 LYS A 34 ? ? 169.01 -46.69 36 13 SER A 3 ? ? -90.92 34.97 37 13 THR A 4 ? ? -161.42 -135.29 38 13 CYS A 5 ? ? 77.90 82.03 39 13 LEU A 6 ? ? -90.07 -61.27 40 13 ASP A 7 ? ? -160.53 90.35 41 13 ALA A 9 ? ? -55.68 79.71 42 14 LEU A 6 ? ? -103.93 -70.45 43 14 ALA A 9 ? ? -53.20 82.34 44 14 ASN A 33 ? ? -63.51 54.89 45 14 LYS A 34 ? ? 174.26 -27.51 46 15 ALA A 9 ? ? -59.23 82.22 47 16 THR A 4 ? ? -123.76 -80.54 48 16 LEU A 8 ? ? -93.43 47.54 49 16 ALA A 9 ? ? -53.19 83.82 50 17 THR A 4 ? ? -117.36 53.76 51 17 ALA A 9 ? ? -60.71 86.26 52 17 ASN A 33 ? ? -65.29 74.53 53 17 LYS A 34 ? ? 172.50 -47.50 54 18 LEU A 8 ? ? -141.74 24.85 55 18 ALA A 9 ? ? -60.64 86.63 56 18 ASN A 33 ? ? -68.40 74.11 57 18 LYS A 34 ? ? 168.73 -43.89 58 19 THR A 4 ? ? -150.45 80.58 59 19 CYS A 5 ? ? -170.15 60.24 60 19 LEU A 6 ? ? -83.47 -74.55 61 19 LEU A 8 ? ? -103.96 40.83 62 19 ALA A 9 ? ? -56.60 82.47 63 19 ASN A 33 ? ? -69.54 61.01 64 19 LYS A 34 ? ? 177.21 -39.90 65 20 CYS A 5 ? ? -140.48 -60.53 66 20 ALA A 9 ? ? -55.37 82.21 67 20 LYS A 34 ? ? 70.99 -28.65 68 21 ASP A 7 ? ? -100.28 56.32 69 21 LEU A 8 ? ? -107.73 47.76 70 21 ALA A 9 ? ? -55.07 83.06 71 21 GLN A 23 ? ? -92.18 -60.45 72 21 PRO A 27 ? ? -84.96 35.99 73 22 ALA A 9 ? ? -54.38 85.24 74 23 ALA A 9 ? ? -61.73 77.48 75 24 SER A 3 ? ? -90.06 -76.41 76 24 LEU A 6 ? ? -128.83 -66.51 77 24 ALA A 9 ? ? -60.69 82.92 78 24 THR A 11 ? ? -79.79 21.63 79 25 CYS A 5 ? ? -113.13 57.02 80 25 ALA A 9 ? ? -55.65 83.63 #