data_1WU0 # _entry.id 1WU0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WU0 pdb_00001wu0 10.2210/pdb1wu0/pdb RCSB RCSB023996 ? ? WWPDB D_1000023996 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WU0 _pdbx_database_status.recvd_initial_deposition_date 2004-11-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1A91 'F1FO ATPASE SUBUNIT C' unspecified PDB 1C0V 'PROTEIN (F1FO ATPASE SUBUNIT C)' unspecified PDB 1C99 'PROTEOLIPID F1FO ATPASE SUBUNIT C' unspecified PDB 1C17 'ATP SYNTHASE SUBUNIT C' unspecified PDB 1QO1 'ATP SYNTHASE ALPHA CHAIN, ATP SYNTHASE BETA CHAIN, ATP SYNTHASE GAMMA CHAIN, ATP SYNTHASE DELTA CHAIN, ATP SYNTHASE PROTEIN 9' unspecified PDB 1ATY 'F1FO ATP SYNTHASE (E.C.3.6.1.34) SUBUNIT C (RESIDUES 9 - 26, 52 - 79) MUTANT WITH ALA 67 REPLACED BY CYS (A67C) (NMR, 9 STRUCTURES)' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nakano, T.' 1 'Ikegami, T.' 2 'Suzuki, T.' 3 'Yoshida, M.' 4 'Akutsu, H.' 5 # _citation.id primary _citation.title 'solution structure TF1Fo subunit c' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nakano, T.' 1 ? primary 'Ikegami, T.' 2 ? primary 'Suzuki, T.' 3 ? primary 'Yoshida, M.' 4 ? primary 'Akutsu, H.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ATP synthase C chain' _entity.formula_weight 7337.780 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.3.14 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'F1Fo-ATPase subunit c, Lipid-binding protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFIYLGR _entity_poly.pdbx_seq_one_letter_code_can MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFIYLGR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 GLY n 1 5 VAL n 1 6 LEU n 1 7 ALA n 1 8 ALA n 1 9 ALA n 1 10 ILE n 1 11 ALA n 1 12 VAL n 1 13 GLY n 1 14 LEU n 1 15 GLY n 1 16 ALA n 1 17 LEU n 1 18 GLY n 1 19 ALA n 1 20 GLY n 1 21 ILE n 1 22 GLY n 1 23 ASN n 1 24 GLY n 1 25 LEU n 1 26 ILE n 1 27 VAL n 1 28 SER n 1 29 ARG n 1 30 THR n 1 31 ILE n 1 32 GLU n 1 33 GLY n 1 34 ILE n 1 35 ALA n 1 36 ARG n 1 37 GLN n 1 38 PRO n 1 39 GLU n 1 40 LEU n 1 41 ARG n 1 42 PRO n 1 43 VAL n 1 44 LEU n 1 45 GLN n 1 46 THR n 1 47 THR n 1 48 MET n 1 49 PHE n 1 50 ILE n 1 51 GLY n 1 52 VAL n 1 53 ALA n 1 54 LEU n 1 55 VAL n 1 56 GLU n 1 57 ALA n 1 58 LEU n 1 59 PRO n 1 60 ILE n 1 61 ILE n 1 62 GLY n 1 63 VAL n 1 64 VAL n 1 65 PHE n 1 66 SER n 1 67 PHE n 1 68 ILE n 1 69 TYR n 1 70 LEU n 1 71 GLY n 1 72 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene atpE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus sp. PS3' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2334 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTR19-C2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ARG 72 72 72 ARG ARG A . n # _exptl.entry_id 1WU0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WU0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WU0 _struct.title 'Solution structure of subunit c of F1Fo-ATP synthase from the thermophilic bacillus PS3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WU0 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'ATPase, ATP synthase, membrane protein, hydrogen ion transport, hydrolase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATPL_BACP3 _struct_ref.pdbx_db_accession P00845 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFIYLGR _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WU0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00845 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 72 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 72 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 3 ? ARG A 36 ? LEU A 3 ARG A 36 1 ? 34 HELX_P HELX_P2 2 PRO A 42 ? GLU A 56 ? PRO A 42 GLU A 56 1 ? 15 HELX_P HELX_P3 3 GLU A 56 ? GLY A 71 ? GLU A 56 GLY A 71 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.42 2 4 O A ILE 68 ? ? H A GLY 71 ? ? 1.60 3 7 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.60 4 10 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.51 5 16 O A VAL 27 ? ? HG1 A THR 30 ? ? 1.56 6 16 O A PHE 67 ? ? H A ARG 72 ? ? 1.60 7 17 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.58 8 21 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.57 9 27 O A PHE 67 ? ? H A ARG 72 ? ? 1.57 10 28 O A LEU 44 ? ? HG1 A THR 47 ? ? 1.47 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -168.67 -169.31 2 2 SER A 2 ? ? 178.91 -176.12 3 2 GLN A 37 ? ? -45.46 161.49 4 3 GLN A 37 ? ? -43.64 160.90 5 4 SER A 2 ? ? 176.93 -169.50 6 4 GLN A 37 ? ? -41.43 162.90 7 4 LEU A 40 ? ? -92.66 33.00 8 5 SER A 2 ? ? 175.03 179.06 9 6 SER A 2 ? ? 174.61 -171.65 10 7 SER A 2 ? ? -66.15 -175.17 11 7 LEU A 40 ? ? -98.63 31.58 12 8 SER A 2 ? ? -161.32 -163.95 13 8 GLN A 37 ? ? -43.79 163.95 14 9 SER A 2 ? ? 170.74 -174.92 15 9 GLN A 37 ? ? -42.35 158.13 16 9 LEU A 40 ? ? -92.81 34.06 17 10 SER A 2 ? ? 177.57 -176.38 18 10 GLN A 37 ? ? -42.30 162.20 19 11 SER A 2 ? ? 169.01 -174.33 20 11 GLN A 37 ? ? -43.47 166.08 21 12 SER A 2 ? ? -178.14 -177.78 22 12 LEU A 40 ? ? -98.99 31.70 23 13 SER A 2 ? ? -168.99 -155.27 24 13 GLN A 37 ? ? -43.08 159.03 25 14 SER A 2 ? ? -178.67 -170.64 26 14 GLN A 37 ? ? -43.13 158.85 27 14 LEU A 40 ? ? -93.06 32.98 28 15 SER A 2 ? ? -55.94 -165.57 29 16 SER A 2 ? ? -176.40 -151.68 30 17 SER A 2 ? ? 177.54 -175.67 31 17 GLN A 37 ? ? -41.86 164.14 32 18 SER A 2 ? ? -160.82 -163.27 33 19 SER A 2 ? ? -175.64 148.49 34 19 GLN A 37 ? ? -40.24 161.59 35 20 SER A 2 ? ? 173.62 -174.12 36 20 LEU A 40 ? ? -93.85 31.82 37 21 SER A 2 ? ? -170.10 -156.79 38 21 GLN A 37 ? ? -40.59 161.70 39 21 LEU A 40 ? ? -97.59 33.12 40 22 SER A 2 ? ? 175.72 -158.93 41 22 GLN A 37 ? ? -41.94 164.40 42 22 LEU A 40 ? ? -98.30 32.66 43 23 GLN A 37 ? ? -49.38 163.98 44 24 SER A 2 ? ? -163.28 -164.38 45 24 GLN A 37 ? ? -42.75 165.99 46 24 LEU A 40 ? ? -98.79 32.23 47 27 SER A 2 ? ? -174.46 -176.54 48 27 GLN A 37 ? ? -38.09 157.63 49 28 SER A 2 ? ? -170.13 -169.56 50 28 GLN A 37 ? ? -44.37 161.14 51 30 GLN A 37 ? ? -42.13 162.82 52 30 LEU A 40 ? ? -95.76 33.04 # _pdbx_nmr_ensemble.entry_id 1WU0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WU0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM subunit c, organic solvent' _pdbx_nmr_sample_details.solvent_system 'CDCl3:CD3OH = 3:1' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 2.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 15N-1H-HSQC 2 1 1 '2D NOESY' 3 1 1 'CBCA(CO)NH' 4 1 1 CBCANH 5 1 1 HNCO 6 1 1 'HN(CA)CO' 7 1 1 HBHANH 8 1 1 'HBHA(CO)NH' 9 1 1 'H(CCO)NH' 10 1 1 'C(CO)NH' # _pdbx_nmr_details.entry_id 1WU0 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1WU0 _pdbx_nmr_refine.method 'simulated annealing torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe 2.2 processing 'Delaglio, F.' 1 Sparky 3.106 'data analysis' 'Goddard, T.D.' 2 CYANA 1.0.6 'structure solution' 'Guentert, P.' 3 TALOS 2003.027.13.05 'data analysis' 'Delaglio, F.' 4 CYANA 1.0.6 refinement 'Guentert, P.' 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 ILE N N N N 107 ILE CA C N S 108 ILE C C N N 109 ILE O O N N 110 ILE CB C N S 111 ILE CG1 C N N 112 ILE CG2 C N N 113 ILE CD1 C N N 114 ILE OXT O N N 115 ILE H H N N 116 ILE H2 H N N 117 ILE HA H N N 118 ILE HB H N N 119 ILE HG12 H N N 120 ILE HG13 H N N 121 ILE HG21 H N N 122 ILE HG22 H N N 123 ILE HG23 H N N 124 ILE HD11 H N N 125 ILE HD12 H N N 126 ILE HD13 H N N 127 ILE HXT H N N 128 LEU N N N N 129 LEU CA C N S 130 LEU C C N N 131 LEU O O N N 132 LEU CB C N N 133 LEU CG C N N 134 LEU CD1 C N N 135 LEU CD2 C N N 136 LEU OXT O N N 137 LEU H H N N 138 LEU H2 H N N 139 LEU HA H N N 140 LEU HB2 H N N 141 LEU HB3 H N N 142 LEU HG H N N 143 LEU HD11 H N N 144 LEU HD12 H N N 145 LEU HD13 H N N 146 LEU HD21 H N N 147 LEU HD22 H N N 148 LEU HD23 H N N 149 LEU HXT H N N 150 MET N N N N 151 MET CA C N S 152 MET C C N N 153 MET O O N N 154 MET CB C N N 155 MET CG C N N 156 MET SD S N N 157 MET CE C N N 158 MET OXT O N N 159 MET H H N N 160 MET H2 H N N 161 MET HA H N N 162 MET HB2 H N N 163 MET HB3 H N N 164 MET HG2 H N N 165 MET HG3 H N N 166 MET HE1 H N N 167 MET HE2 H N N 168 MET HE3 H N N 169 MET HXT H N N 170 PHE N N N N 171 PHE CA C N S 172 PHE C C N N 173 PHE O O N N 174 PHE CB C N N 175 PHE CG C Y N 176 PHE CD1 C Y N 177 PHE CD2 C Y N 178 PHE CE1 C Y N 179 PHE CE2 C Y N 180 PHE CZ C Y N 181 PHE OXT O N N 182 PHE H H N N 183 PHE H2 H N N 184 PHE HA H N N 185 PHE HB2 H N N 186 PHE HB3 H N N 187 PHE HD1 H N N 188 PHE HD2 H N N 189 PHE HE1 H N N 190 PHE HE2 H N N 191 PHE HZ H N N 192 PHE HXT H N N 193 PRO N N N N 194 PRO CA C N S 195 PRO C C N N 196 PRO O O N N 197 PRO CB C N N 198 PRO CG C N N 199 PRO CD C N N 200 PRO OXT O N N 201 PRO H H N N 202 PRO HA H N N 203 PRO HB2 H N N 204 PRO HB3 H N N 205 PRO HG2 H N N 206 PRO HG3 H N N 207 PRO HD2 H N N 208 PRO HD3 H N N 209 PRO HXT H N N 210 SER N N N N 211 SER CA C N S 212 SER C C N N 213 SER O O N N 214 SER CB C N N 215 SER OG O N N 216 SER OXT O N N 217 SER H H N N 218 SER H2 H N N 219 SER HA H N N 220 SER HB2 H N N 221 SER HB3 H N N 222 SER HG H N N 223 SER HXT H N N 224 THR N N N N 225 THR CA C N S 226 THR C C N N 227 THR O O N N 228 THR CB C N R 229 THR OG1 O N N 230 THR CG2 C N N 231 THR OXT O N N 232 THR H H N N 233 THR H2 H N N 234 THR HA H N N 235 THR HB H N N 236 THR HG1 H N N 237 THR HG21 H N N 238 THR HG22 H N N 239 THR HG23 H N N 240 THR HXT H N N 241 TYR N N N N 242 TYR CA C N S 243 TYR C C N N 244 TYR O O N N 245 TYR CB C N N 246 TYR CG C Y N 247 TYR CD1 C Y N 248 TYR CD2 C Y N 249 TYR CE1 C Y N 250 TYR CE2 C Y N 251 TYR CZ C Y N 252 TYR OH O N N 253 TYR OXT O N N 254 TYR H H N N 255 TYR H2 H N N 256 TYR HA H N N 257 TYR HB2 H N N 258 TYR HB3 H N N 259 TYR HD1 H N N 260 TYR HD2 H N N 261 TYR HE1 H N N 262 TYR HE2 H N N 263 TYR HH H N N 264 TYR HXT H N N 265 VAL N N N N 266 VAL CA C N S 267 VAL C C N N 268 VAL O O N N 269 VAL CB C N N 270 VAL CG1 C N N 271 VAL CG2 C N N 272 VAL OXT O N N 273 VAL H H N N 274 VAL H2 H N N 275 VAL HA H N N 276 VAL HB H N N 277 VAL HG11 H N N 278 VAL HG12 H N N 279 VAL HG13 H N N 280 VAL HG21 H N N 281 VAL HG22 H N N 282 VAL HG23 H N N 283 VAL HXT H N N 284 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 ILE N CA sing N N 101 ILE N H sing N N 102 ILE N H2 sing N N 103 ILE CA C sing N N 104 ILE CA CB sing N N 105 ILE CA HA sing N N 106 ILE C O doub N N 107 ILE C OXT sing N N 108 ILE CB CG1 sing N N 109 ILE CB CG2 sing N N 110 ILE CB HB sing N N 111 ILE CG1 CD1 sing N N 112 ILE CG1 HG12 sing N N 113 ILE CG1 HG13 sing N N 114 ILE CG2 HG21 sing N N 115 ILE CG2 HG22 sing N N 116 ILE CG2 HG23 sing N N 117 ILE CD1 HD11 sing N N 118 ILE CD1 HD12 sing N N 119 ILE CD1 HD13 sing N N 120 ILE OXT HXT sing N N 121 LEU N CA sing N N 122 LEU N H sing N N 123 LEU N H2 sing N N 124 LEU CA C sing N N 125 LEU CA CB sing N N 126 LEU CA HA sing N N 127 LEU C O doub N N 128 LEU C OXT sing N N 129 LEU CB CG sing N N 130 LEU CB HB2 sing N N 131 LEU CB HB3 sing N N 132 LEU CG CD1 sing N N 133 LEU CG CD2 sing N N 134 LEU CG HG sing N N 135 LEU CD1 HD11 sing N N 136 LEU CD1 HD12 sing N N 137 LEU CD1 HD13 sing N N 138 LEU CD2 HD21 sing N N 139 LEU CD2 HD22 sing N N 140 LEU CD2 HD23 sing N N 141 LEU OXT HXT sing N N 142 MET N CA sing N N 143 MET N H sing N N 144 MET N H2 sing N N 145 MET CA C sing N N 146 MET CA CB sing N N 147 MET CA HA sing N N 148 MET C O doub N N 149 MET C OXT sing N N 150 MET CB CG sing N N 151 MET CB HB2 sing N N 152 MET CB HB3 sing N N 153 MET CG SD sing N N 154 MET CG HG2 sing N N 155 MET CG HG3 sing N N 156 MET SD CE sing N N 157 MET CE HE1 sing N N 158 MET CE HE2 sing N N 159 MET CE HE3 sing N N 160 MET OXT HXT sing N N 161 PHE N CA sing N N 162 PHE N H sing N N 163 PHE N H2 sing N N 164 PHE CA C sing N N 165 PHE CA CB sing N N 166 PHE CA HA sing N N 167 PHE C O doub N N 168 PHE C OXT sing N N 169 PHE CB CG sing N N 170 PHE CB HB2 sing N N 171 PHE CB HB3 sing N N 172 PHE CG CD1 doub Y N 173 PHE CG CD2 sing Y N 174 PHE CD1 CE1 sing Y N 175 PHE CD1 HD1 sing N N 176 PHE CD2 CE2 doub Y N 177 PHE CD2 HD2 sing N N 178 PHE CE1 CZ doub Y N 179 PHE CE1 HE1 sing N N 180 PHE CE2 CZ sing Y N 181 PHE CE2 HE2 sing N N 182 PHE CZ HZ sing N N 183 PHE OXT HXT sing N N 184 PRO N CA sing N N 185 PRO N CD sing N N 186 PRO N H sing N N 187 PRO CA C sing N N 188 PRO CA CB sing N N 189 PRO CA HA sing N N 190 PRO C O doub N N 191 PRO C OXT sing N N 192 PRO CB CG sing N N 193 PRO CB HB2 sing N N 194 PRO CB HB3 sing N N 195 PRO CG CD sing N N 196 PRO CG HG2 sing N N 197 PRO CG HG3 sing N N 198 PRO CD HD2 sing N N 199 PRO CD HD3 sing N N 200 PRO OXT HXT sing N N 201 SER N CA sing N N 202 SER N H sing N N 203 SER N H2 sing N N 204 SER CA C sing N N 205 SER CA CB sing N N 206 SER CA HA sing N N 207 SER C O doub N N 208 SER C OXT sing N N 209 SER CB OG sing N N 210 SER CB HB2 sing N N 211 SER CB HB3 sing N N 212 SER OG HG sing N N 213 SER OXT HXT sing N N 214 THR N CA sing N N 215 THR N H sing N N 216 THR N H2 sing N N 217 THR CA C sing N N 218 THR CA CB sing N N 219 THR CA HA sing N N 220 THR C O doub N N 221 THR C OXT sing N N 222 THR CB OG1 sing N N 223 THR CB CG2 sing N N 224 THR CB HB sing N N 225 THR OG1 HG1 sing N N 226 THR CG2 HG21 sing N N 227 THR CG2 HG22 sing N N 228 THR CG2 HG23 sing N N 229 THR OXT HXT sing N N 230 TYR N CA sing N N 231 TYR N H sing N N 232 TYR N H2 sing N N 233 TYR CA C sing N N 234 TYR CA CB sing N N 235 TYR CA HA sing N N 236 TYR C O doub N N 237 TYR C OXT sing N N 238 TYR CB CG sing N N 239 TYR CB HB2 sing N N 240 TYR CB HB3 sing N N 241 TYR CG CD1 doub Y N 242 TYR CG CD2 sing Y N 243 TYR CD1 CE1 sing Y N 244 TYR CD1 HD1 sing N N 245 TYR CD2 CE2 doub Y N 246 TYR CD2 HD2 sing N N 247 TYR CE1 CZ doub Y N 248 TYR CE1 HE1 sing N N 249 TYR CE2 CZ sing Y N 250 TYR CE2 HE2 sing N N 251 TYR CZ OH sing N N 252 TYR OH HH sing N N 253 TYR OXT HXT sing N N 254 VAL N CA sing N N 255 VAL N H sing N N 256 VAL N H2 sing N N 257 VAL CA C sing N N 258 VAL CA CB sing N N 259 VAL CA HA sing N N 260 VAL C O doub N N 261 VAL C OXT sing N N 262 VAL CB CG1 sing N N 263 VAL CB CG2 sing N N 264 VAL CB HB sing N N 265 VAL CG1 HG11 sing N N 266 VAL CG1 HG12 sing N N 267 VAL CG1 HG13 sing N N 268 VAL CG2 HG21 sing N N 269 VAL CG2 HG22 sing N N 270 VAL CG2 HG23 sing N N 271 VAL OXT HXT sing N N 272 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 800 2 ? Bruker DRX 600 3 ? Bruker DRX 500 4 ? Bruker AVANCE 400 # _atom_sites.entry_id 1WU0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_