data_1WV8 # _entry.id 1WV8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WV8 pdb_00001wv8 10.2210/pdb1wv8/pdb RCSB RCSB024040 ? ? WWPDB D_1000024040 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-06-12 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Version format compliance' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_entry_details 5 4 'Structure model' pdbx_modification_feature 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WV8 _pdbx_database_status.recvd_initial_deposition_date 2004-12-12 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ttk003001413.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mizohata, E.' 1 'Hattori, M.' 2 'Kuramitsu, S.' 3 'Shirouzu, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Crystal structure of the hypothetical protein TTHA1013 from Thermus thermophilus HB8' _citation.journal_abbrev Proteins _citation.journal_volume 61 _citation.page_first 1117 _citation.page_last 1120 _citation.year 2005 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16250002 _citation.pdbx_database_id_DOI 10.1002/prot.20692 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hattori, M.' 1 ? primary 'Mizohata, E.' 2 ? primary 'Manzoku, M.' 3 ? primary 'Bessho, Y.' 4 ? primary 'Murayama, K.' 5 ? primary 'Terada, T.' 6 ? primary 'Kuramitsu, S.' 7 ? primary 'Shirouzu, M.' 8 ? primary 'Yokoyama, S.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'hypothetical protein TTHA1013' 8013.877 1 ? ? ? ? 2 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TT1413 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)RTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAV(MSE)VPELLEENGVALELPVELRLEATRPLVF S ; _entity_poly.pdbx_seq_one_letter_code_can MRTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAVMVPELLEENGVALELPVELRLEATRPLVFS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ttk003001413.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ARG n 1 3 THR n 1 4 LEU n 1 5 LYS n 1 6 VAL n 1 7 GLN n 1 8 ALA n 1 9 LEU n 1 10 TRP n 1 11 ASP n 1 12 GLY n 1 13 GLU n 1 14 ALA n 1 15 GLY n 1 16 VAL n 1 17 TRP n 1 18 VAL n 1 19 ALA n 1 20 GLU n 1 21 SER n 1 22 ASP n 1 23 ASP n 1 24 VAL n 1 25 PRO n 1 26 GLY n 1 27 LEU n 1 28 ALA n 1 29 THR n 1 30 GLU n 1 31 ALA n 1 32 ALA n 1 33 THR n 1 34 LEU n 1 35 GLU n 1 36 GLU n 1 37 LEU n 1 38 LEU n 1 39 ALA n 1 40 LYS n 1 41 LEU n 1 42 ALA n 1 43 VAL n 1 44 MSE n 1 45 VAL n 1 46 PRO n 1 47 GLU n 1 48 LEU n 1 49 LEU n 1 50 GLU n 1 51 GLU n 1 52 ASN n 1 53 GLY n 1 54 VAL n 1 55 ALA n 1 56 LEU n 1 57 GLU n 1 58 LEU n 1 59 PRO n 1 60 VAL n 1 61 GLU n 1 62 LEU n 1 63 ARG n 1 64 LEU n 1 65 GLU n 1 66 ALA n 1 67 THR n 1 68 ARG n 1 69 PRO n 1 70 LEU n 1 71 VAL n 1 72 PHE n 1 73 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Thermus thermophilus' _entity_src_gen.gene_src_strain HB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300852 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MSE 44 44 44 MSE MSE A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 SER 73 73 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 74 1 HOH WAT A . B 2 HOH 2 75 2 HOH WAT A . B 2 HOH 3 76 3 HOH WAT A . B 2 HOH 4 77 4 HOH WAT A . B 2 HOH 5 78 5 HOH WAT A . B 2 HOH 6 79 6 HOH WAT A . B 2 HOH 7 80 7 HOH WAT A . B 2 HOH 8 81 8 HOH WAT A . B 2 HOH 9 82 9 HOH WAT A . B 2 HOH 10 83 10 HOH WAT A . B 2 HOH 11 84 11 HOH WAT A . B 2 HOH 12 85 12 HOH WAT A . B 2 HOH 13 86 13 HOH WAT A . B 2 HOH 14 87 14 HOH WAT A . B 2 HOH 15 88 15 HOH WAT A . B 2 HOH 16 89 16 HOH WAT A . B 2 HOH 17 90 17 HOH WAT A . B 2 HOH 18 91 18 HOH WAT A . B 2 HOH 19 92 19 HOH WAT A . B 2 HOH 20 93 20 HOH WAT A . B 2 HOH 21 94 21 HOH WAT A . B 2 HOH 22 95 22 HOH WAT A . B 2 HOH 23 96 23 HOH WAT A . B 2 HOH 24 97 24 HOH WAT A . B 2 HOH 25 98 25 HOH WAT A . B 2 HOH 26 99 26 HOH WAT A . B 2 HOH 27 100 27 HOH WAT A . B 2 HOH 28 101 28 HOH WAT A . B 2 HOH 29 102 29 HOH WAT A . B 2 HOH 30 103 30 HOH WAT A . B 2 HOH 31 104 31 HOH WAT A . B 2 HOH 32 105 32 HOH WAT A . B 2 HOH 33 106 33 HOH WAT A . B 2 HOH 34 107 34 HOH WAT A . B 2 HOH 35 108 35 HOH WAT A . B 2 HOH 36 109 36 HOH WAT A . B 2 HOH 37 110 37 HOH WAT A . B 2 HOH 38 111 38 HOH WAT A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # _cell.entry_id 1WV8 _cell.length_a 51.897 _cell.length_b 51.897 _cell.length_c 117.727 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WV8 _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1WV8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.878 _exptl_crystal.density_percent_sol 56 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details 'ammonium sulfate, sodium acetate, PEG4000, Tris-HCl, Sodium chloride, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type RIGAKU _diffrn_detector.pdbx_collection_date 2004-06-17 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.96300 1.0 2 0.97911 1.0 3 0.97937 1.0 4 1.00000 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL26B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.96300, 0.97911, 0.97937, 1.00000' # _reflns.entry_id 1WV8 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.2 _reflns.number_obs 5283 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 30.3 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1WV8 _refine.ls_number_reflns_obs 5222 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 573827.92 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.95 _refine.ls_d_res_high 2.20 _refine.ls_percent_reflns_obs 99.6 _refine.ls_R_factor_obs 0.259 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.259 _refine.ls_R_factor_R_free 0.273 _refine.ls_R_factor_R_free_error 0.016 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.5 _refine.ls_number_reflns_R_free 285 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 53.6 _refine.aniso_B[1][1] 3.19 _refine.aniso_B[2][2] 3.19 _refine.aniso_B[3][3] -6.39 _refine.aniso_B[1][2] -1.96 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.355245 _refine.solvent_model_param_bsol 51.5787 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1WV8 _refine_analyze.Luzzati_coordinate_error_obs 0.35 _refine_analyze.Luzzati_sigma_a_obs 0.33 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.34 _refine_analyze.Luzzati_sigma_a_free 0.38 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 541 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 579 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 44.95 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.7 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.88 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.20 _refine_ls_shell.d_res_low 2.34 _refine_ls_shell.number_reflns_R_work 797 _refine_ls_shell.R_factor_R_work 0.316 _refine_ls_shell.percent_reflns_obs 99.5 _refine_ls_shell.R_factor_R_free 0.331 _refine_ls_shell.R_factor_R_free_error 0.055 _refine_ls_shell.percent_reflns_R_free 4.3 _refine_ls_shell.number_reflns_R_free 36 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 1WV8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WV8 _struct.title 'Crystal structure of hypothetical protein TTHA1013 from an extremely thermophilic bacterium thermus thermophilus HB8' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WV8 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'Hypothetical, STRUCTURAL GENOMICS, Unknown function, novel fold, RIKEN Structural Genomics/Proteomics Initiative, RSGI' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5SJJ5_THET8 _struct_ref.pdbx_db_accession Q5SJJ5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MRTLKVQALWDGEAGVWVAESDDVPGLATEAATLEELLAKLAVMVPELLEENGVALELPVELRLEATRPLVFS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WV8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5SJJ5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 73 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WV8 MSE A 1 ? UNP Q5SJJ5 MET 1 'modified residue' 1 1 1 1WV8 MSE A 44 ? UNP Q5SJJ5 MET 44 'modified residue' 44 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2320 ? 1 MORE -15 ? 1 'SSA (A^2)' 8050 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_556 -x+y,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 117.7270000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 33 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 52 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 33 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 52 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 43 C ? ? ? 1_555 A MSE 44 N ? ? A VAL 43 A MSE 44 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A MSE 44 C ? ? ? 1_555 A VAL 45 N ? ? A MSE 44 A VAL 45 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id MSE _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 44 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id MSE _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 44 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id MET _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id MSE _pdbx_modification_feature.type Selenomethionine _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 58 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 58 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 59 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 59 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.23 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 30 ? ALA A 31 ? GLU A 30 ALA A 31 A 2 VAL A 16 ? GLU A 20 ? VAL A 16 GLU A 20 A 3 THR A 3 ? ASP A 11 ? THR A 3 ASP A 11 A 4 GLU A 61 ? GLU A 65 ? GLU A 61 GLU A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 31 ? O ALA A 31 N TRP A 17 ? N TRP A 17 A 2 3 O GLU A 20 ? O GLU A 20 N GLN A 7 ? N GLN A 7 A 3 4 N VAL A 6 ? N VAL A 6 O GLU A 65 ? O GLU A 65 # _pdbx_entry_details.entry_id 1WV8 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 106 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 106 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_665 _pdbx_validate_symm_contact.dist 1.60 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id VAL _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 54 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -45.39 _pdbx_validate_torsion.psi -90.51 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 44 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 44 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 85 ? B HOH . 2 1 A HOH 110 ? B HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 73 ? A SER 73 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HOH O O N N 123 HOH H1 H N N 124 HOH H2 H N N 125 LEU N N N N 126 LEU CA C N S 127 LEU C C N N 128 LEU O O N N 129 LEU CB C N N 130 LEU CG C N N 131 LEU CD1 C N N 132 LEU CD2 C N N 133 LEU OXT O N N 134 LEU H H N N 135 LEU H2 H N N 136 LEU HA H N N 137 LEU HB2 H N N 138 LEU HB3 H N N 139 LEU HG H N N 140 LEU HD11 H N N 141 LEU HD12 H N N 142 LEU HD13 H N N 143 LEU HD21 H N N 144 LEU HD22 H N N 145 LEU HD23 H N N 146 LEU HXT H N N 147 LYS N N N N 148 LYS CA C N S 149 LYS C C N N 150 LYS O O N N 151 LYS CB C N N 152 LYS CG C N N 153 LYS CD C N N 154 LYS CE C N N 155 LYS NZ N N N 156 LYS OXT O N N 157 LYS H H N N 158 LYS H2 H N N 159 LYS HA H N N 160 LYS HB2 H N N 161 LYS HB3 H N N 162 LYS HG2 H N N 163 LYS HG3 H N N 164 LYS HD2 H N N 165 LYS HD3 H N N 166 LYS HE2 H N N 167 LYS HE3 H N N 168 LYS HZ1 H N N 169 LYS HZ2 H N N 170 LYS HZ3 H N N 171 LYS HXT H N N 172 MET N N N N 173 MET CA C N S 174 MET C C N N 175 MET O O N N 176 MET CB C N N 177 MET CG C N N 178 MET SD S N N 179 MET CE C N N 180 MET OXT O N N 181 MET H H N N 182 MET H2 H N N 183 MET HA H N N 184 MET HB2 H N N 185 MET HB3 H N N 186 MET HG2 H N N 187 MET HG3 H N N 188 MET HE1 H N N 189 MET HE2 H N N 190 MET HE3 H N N 191 MET HXT H N N 192 MSE N N N N 193 MSE CA C N S 194 MSE C C N N 195 MSE O O N N 196 MSE OXT O N N 197 MSE CB C N N 198 MSE CG C N N 199 MSE SE SE N N 200 MSE CE C N N 201 MSE H H N N 202 MSE H2 H N N 203 MSE HA H N N 204 MSE HXT H N N 205 MSE HB2 H N N 206 MSE HB3 H N N 207 MSE HG2 H N N 208 MSE HG3 H N N 209 MSE HE1 H N N 210 MSE HE2 H N N 211 MSE HE3 H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TRP N N N N 284 TRP CA C N S 285 TRP C C N N 286 TRP O O N N 287 TRP CB C N N 288 TRP CG C Y N 289 TRP CD1 C Y N 290 TRP CD2 C Y N 291 TRP NE1 N Y N 292 TRP CE2 C Y N 293 TRP CE3 C Y N 294 TRP CZ2 C Y N 295 TRP CZ3 C Y N 296 TRP CH2 C Y N 297 TRP OXT O N N 298 TRP H H N N 299 TRP H2 H N N 300 TRP HA H N N 301 TRP HB2 H N N 302 TRP HB3 H N N 303 TRP HD1 H N N 304 TRP HE1 H N N 305 TRP HE3 H N N 306 TRP HZ2 H N N 307 TRP HZ3 H N N 308 TRP HH2 H N N 309 TRP HXT H N N 310 VAL N N N N 311 VAL CA C N S 312 VAL C C N N 313 VAL O O N N 314 VAL CB C N N 315 VAL CG1 C N N 316 VAL CG2 C N N 317 VAL OXT O N N 318 VAL H H N N 319 VAL H2 H N N 320 VAL HA H N N 321 VAL HB H N N 322 VAL HG11 H N N 323 VAL HG12 H N N 324 VAL HG13 H N N 325 VAL HG21 H N N 326 VAL HG22 H N N 327 VAL HG23 H N N 328 VAL HXT H N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 LEU N CA sing N N 118 LEU N H sing N N 119 LEU N H2 sing N N 120 LEU CA C sing N N 121 LEU CA CB sing N N 122 LEU CA HA sing N N 123 LEU C O doub N N 124 LEU C OXT sing N N 125 LEU CB CG sing N N 126 LEU CB HB2 sing N N 127 LEU CB HB3 sing N N 128 LEU CG CD1 sing N N 129 LEU CG CD2 sing N N 130 LEU CG HG sing N N 131 LEU CD1 HD11 sing N N 132 LEU CD1 HD12 sing N N 133 LEU CD1 HD13 sing N N 134 LEU CD2 HD21 sing N N 135 LEU CD2 HD22 sing N N 136 LEU CD2 HD23 sing N N 137 LEU OXT HXT sing N N 138 LYS N CA sing N N 139 LYS N H sing N N 140 LYS N H2 sing N N 141 LYS CA C sing N N 142 LYS CA CB sing N N 143 LYS CA HA sing N N 144 LYS C O doub N N 145 LYS C OXT sing N N 146 LYS CB CG sing N N 147 LYS CB HB2 sing N N 148 LYS CB HB3 sing N N 149 LYS CG CD sing N N 150 LYS CG HG2 sing N N 151 LYS CG HG3 sing N N 152 LYS CD CE sing N N 153 LYS CD HD2 sing N N 154 LYS CD HD3 sing N N 155 LYS CE NZ sing N N 156 LYS CE HE2 sing N N 157 LYS CE HE3 sing N N 158 LYS NZ HZ1 sing N N 159 LYS NZ HZ2 sing N N 160 LYS NZ HZ3 sing N N 161 LYS OXT HXT sing N N 162 MET N CA sing N N 163 MET N H sing N N 164 MET N H2 sing N N 165 MET CA C sing N N 166 MET CA CB sing N N 167 MET CA HA sing N N 168 MET C O doub N N 169 MET C OXT sing N N 170 MET CB CG sing N N 171 MET CB HB2 sing N N 172 MET CB HB3 sing N N 173 MET CG SD sing N N 174 MET CG HG2 sing N N 175 MET CG HG3 sing N N 176 MET SD CE sing N N 177 MET CE HE1 sing N N 178 MET CE HE2 sing N N 179 MET CE HE3 sing N N 180 MET OXT HXT sing N N 181 MSE N CA sing N N 182 MSE N H sing N N 183 MSE N H2 sing N N 184 MSE CA C sing N N 185 MSE CA CB sing N N 186 MSE CA HA sing N N 187 MSE C O doub N N 188 MSE C OXT sing N N 189 MSE OXT HXT sing N N 190 MSE CB CG sing N N 191 MSE CB HB2 sing N N 192 MSE CB HB3 sing N N 193 MSE CG SE sing N N 194 MSE CG HG2 sing N N 195 MSE CG HG3 sing N N 196 MSE SE CE sing N N 197 MSE CE HE1 sing N N 198 MSE CE HE2 sing N N 199 MSE CE HE3 sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 VAL N CA sing N N 298 VAL N H sing N N 299 VAL N H2 sing N N 300 VAL CA C sing N N 301 VAL CA CB sing N N 302 VAL CA HA sing N N 303 VAL C O doub N N 304 VAL C OXT sing N N 305 VAL CB CG1 sing N N 306 VAL CB CG2 sing N N 307 VAL CB HB sing N N 308 VAL CG1 HG11 sing N N 309 VAL CG1 HG12 sing N N 310 VAL CG1 HG13 sing N N 311 VAL CG2 HG21 sing N N 312 VAL CG2 HG22 sing N N 313 VAL CG2 HG23 sing N N 314 VAL OXT HXT sing N N 315 # _atom_sites.entry_id 1WV8 _atom_sites.fract_transf_matrix[1][1] 0.019269 _atom_sites.fract_transf_matrix[1][2] 0.011125 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022250 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008494 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_