data_1WVK # _entry.id 1WVK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WVK pdb_00001wvk 10.2210/pdb1wvk/pdb RCSB RCSB024052 ? ? WWPDB D_1000024052 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-04 2 'Structure model' 1 1 2008-02-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WVK _pdbx_database_status.recvd_initial_deposition_date 2004-12-16 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id GO.7474 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tyler, R.C.' 1 'Tonelli, M.' 2 'Lee, M.' 3 'Markley, J.L.' 4 'Center for Eukaryotic Structural Genomics (CESG)' 5 # _citation.id primary _citation.title 'NMR Solution Structure of the Partially Disordered Protein At2g23090 from Arabidopsis thaliana' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tyler, R.C.' 1 ? primary 'Tonelli, M.' 2 ? primary 'Lee, M.' 3 ? primary 'Markley, J.L.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description At2g23090/F21P24.15 _entity.formula_weight 9390.949 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHHHHHHLEGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVAC FPHLKK ; _entity_poly.pdbx_seq_one_letter_code_can ;GHHHHHHLEGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVAC FPHLKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GO.7474 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 LEU n 1 9 GLU n 1 10 GLY n 1 11 GLY n 1 12 GLY n 1 13 ASN n 1 14 ALA n 1 15 GLN n 1 16 LYS n 1 17 SER n 1 18 ALA n 1 19 MET n 1 20 ALA n 1 21 ARG n 1 22 ALA n 1 23 LYS n 1 24 ASN n 1 25 LEU n 1 26 GLU n 1 27 LYS n 1 28 ALA n 1 29 LYS n 1 30 ALA n 1 31 ALA n 1 32 GLY n 1 33 LYS n 1 34 GLY n 1 35 SER n 1 36 GLN n 1 37 LEU n 1 38 GLU n 1 39 ALA n 1 40 ASN n 1 41 LYS n 1 42 LYS n 1 43 ALA n 1 44 MET n 1 45 SER n 1 46 ILE n 1 47 GLN n 1 48 CYS n 1 49 LYS n 1 50 VAL n 1 51 CYS n 1 52 MET n 1 53 GLN n 1 54 THR n 1 55 PHE n 1 56 ILE n 1 57 CYS n 1 58 THR n 1 59 THR n 1 60 SER n 1 61 GLU n 1 62 VAL n 1 63 LYS n 1 64 CYS n 1 65 ARG n 1 66 GLU n 1 67 HIS n 1 68 ALA n 1 69 GLU n 1 70 ALA n 1 71 LYS n 1 72 HIS n 1 73 PRO n 1 74 LYS n 1 75 ALA n 1 76 ASP n 1 77 VAL n 1 78 VAL n 1 79 ALA n 1 80 CYS n 1 81 PHE n 1 82 PRO n 1 83 HIS n 1 84 LEU n 1 85 LYS n 1 86 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene AT2G23090 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'CELL-FREE SYNTHESIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PEU-HIS _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'wheat germ cell-free, in vitro expression' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LYS 86 86 86 LYS LYS A . n # _exptl.entry_id 1WVK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WVK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WVK _struct.title 'NMR Solution Structure of the Partially Disordered Protein At2g23090 from Arabidopsis thaliana' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WVK _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Structural genomics, protein structure initiative, PSI, cell free, Center for Eukaryotic Structural Genomics, CESG, At2g23090.1, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y2309_ARATH _struct_ref.pdbx_db_accession O64818 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVACFPHLKK _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WVK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O64818 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WVK GLY A 1 ? UNP O64818 ? ? 'expression tag' 1 1 1 1WVK HIS A 2 ? UNP O64818 ? ? 'expression tag' 2 2 1 1WVK HIS A 3 ? UNP O64818 ? ? 'expression tag' 3 3 1 1WVK HIS A 4 ? UNP O64818 ? ? 'expression tag' 4 4 1 1WVK HIS A 5 ? UNP O64818 ? ? 'expression tag' 5 5 1 1WVK HIS A 6 ? UNP O64818 ? ? 'expression tag' 6 6 1 1WVK HIS A 7 ? UNP O64818 ? ? 'expression tag' 7 7 1 1WVK LEU A 8 ? UNP O64818 ? ? 'expression tag' 8 8 1 1WVK GLU A 9 ? UNP O64818 ? ? 'expression tag' 9 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 14 ? ALA A 18 ? ALA A 14 ALA A 18 5 ? 5 HELX_P HELX_P2 2 GLU A 61 ? ALA A 70 ? GLU A 61 ALA A 70 1 ? 10 HELX_P HELX_P3 3 ALA A 75 ? ALA A 79 ? ALA A 75 ALA A 79 5 ? 5 HELX_P HELX_P4 4 PHE A 81 ? LYS A 85 ? PHE A 81 LYS A 85 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 46 ? CYS A 48 ? ILE A 46 CYS A 48 A 2 GLN A 53 ? PHE A 55 ? GLN A 53 PHE A 55 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 46 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 46 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 55 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 55 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 OE1 A GLU 38 ? ? HZ1 A LYS 41 ? ? 1.58 2 7 HG A SER 45 ? ? O A PHE 55 ? ? 1.58 3 7 OE2 A GLU 26 ? ? HZ1 A LYS 27 ? ? 1.60 4 8 OE2 A GLU 61 ? ? HD1 A HIS 83 ? ? 1.57 5 8 HE2 A HIS 67 ? ? OXT A LYS 86 ? ? 1.59 6 9 OE2 A GLU 69 ? ? HZ1 A LYS 85 ? ? 1.58 7 11 OD1 A ASP 76 ? ? HZ1 A LYS 85 ? ? 1.50 8 14 O A GLU 61 ? ? HG A CYS 64 ? ? 1.57 9 14 OE1 A GLU 61 ? ? HH21 A ARG 65 ? ? 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 11 CZ A PHE 81 ? ? CE2 A PHE 81 ? ? 1.483 1.369 0.114 0.019 N 2 14 CE1 A PHE 81 ? ? CZ A PHE 81 ? ? 1.520 1.369 0.151 0.019 N 3 14 CZ A PHE 81 ? ? CE2 A PHE 81 ? ? 1.226 1.369 -0.143 0.019 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 2 ? ? -153.23 16.43 2 1 HIS A 3 ? ? -174.70 -41.33 3 1 HIS A 5 ? ? -62.98 -70.81 4 1 LEU A 8 ? ? 64.24 97.78 5 1 ASN A 13 ? ? 60.87 97.63 6 1 LEU A 25 ? ? -178.04 114.01 7 1 LYS A 27 ? ? 64.29 -85.19 8 1 ALA A 28 ? ? 164.12 -56.65 9 1 ALA A 31 ? ? -135.80 -66.49 10 1 LYS A 33 ? ? -155.66 -34.64 11 1 SER A 35 ? ? 69.85 88.57 12 1 LEU A 37 ? ? 69.73 -3.81 13 1 MET A 44 ? ? 67.71 79.10 14 1 SER A 45 ? ? -71.95 -87.33 15 1 CYS A 51 ? ? -161.37 -82.01 16 1 MET A 52 ? ? -164.38 22.10 17 1 SER A 60 ? ? -71.36 -81.38 18 1 GLU A 61 ? ? 178.99 -36.13 19 1 LYS A 71 ? ? -132.58 -84.57 20 1 LYS A 74 ? ? -165.21 20.41 21 1 ALA A 75 ? ? 64.07 -82.30 22 1 ASP A 76 ? ? 53.78 -88.43 23 1 PHE A 81 ? ? -155.58 83.97 24 1 PRO A 82 ? ? -63.19 3.44 25 2 LEU A 8 ? ? 73.85 -68.31 26 2 ASN A 13 ? ? 72.63 147.25 27 2 ALA A 14 ? ? -169.91 -74.35 28 2 LYS A 16 ? ? 68.04 -10.97 29 2 SER A 17 ? ? -77.86 31.82 30 2 ASN A 24 ? ? -109.55 -72.65 31 2 ALA A 28 ? ? -127.74 -54.80 32 2 ALA A 31 ? ? -155.85 -69.41 33 2 SER A 35 ? ? 59.16 -166.56 34 2 GLN A 36 ? ? -177.38 -33.47 35 2 ALA A 39 ? ? 70.35 -82.14 36 2 LYS A 42 ? ? 67.73 102.21 37 2 SER A 45 ? ? 56.16 -96.78 38 2 CYS A 51 ? ? -169.26 -77.20 39 2 MET A 52 ? ? -169.41 32.28 40 2 LYS A 71 ? ? -118.27 -81.01 41 2 ASP A 76 ? ? -115.12 -76.79 42 2 PHE A 81 ? ? -167.85 89.32 43 2 PRO A 82 ? ? -63.91 3.91 44 3 LEU A 8 ? ? 72.84 153.93 45 3 ASN A 13 ? ? 67.06 -170.65 46 3 ALA A 14 ? ? -167.05 -103.09 47 3 GLN A 15 ? ? -107.97 -72.25 48 3 MET A 19 ? ? -160.91 -28.82 49 3 LYS A 23 ? ? 45.81 74.58 50 3 LEU A 25 ? ? -135.29 -79.60 51 3 LYS A 33 ? ? 72.90 -53.92 52 3 LEU A 37 ? ? 70.49 -45.25 53 3 SER A 45 ? ? 51.67 -104.76 54 3 CYS A 51 ? ? -156.67 -83.11 55 3 MET A 52 ? ? 179.90 47.51 56 3 THR A 58 ? ? 54.34 -4.89 57 3 THR A 59 ? ? -155.93 -83.90 58 3 SER A 60 ? ? -161.20 10.36 59 3 GLU A 61 ? ? 68.51 -52.04 60 3 LYS A 71 ? ? -120.65 -86.48 61 3 LYS A 74 ? ? -170.03 106.14 62 3 ASP A 76 ? ? -86.94 -90.75 63 3 PHE A 81 ? ? -160.36 88.67 64 3 PRO A 82 ? ? -60.01 6.73 65 4 HIS A 4 ? ? 68.58 -177.10 66 4 HIS A 6 ? ? -137.86 -38.78 67 4 LEU A 8 ? ? 68.40 106.80 68 4 GLU A 9 ? ? -121.50 -71.34 69 4 ASN A 13 ? ? 75.65 94.99 70 4 ALA A 14 ? ? -109.62 -167.12 71 4 GLN A 15 ? ? -48.28 150.03 72 4 LYS A 16 ? ? 74.74 -43.57 73 4 ALA A 18 ? ? -87.35 -71.40 74 4 ALA A 30 ? ? -150.77 -40.34 75 4 SER A 35 ? ? 58.96 -170.94 76 4 ALA A 39 ? ? 52.76 72.97 77 4 LYS A 42 ? ? 61.93 -82.67 78 4 SER A 45 ? ? 52.00 -92.18 79 4 CYS A 51 ? ? -153.96 -67.73 80 4 MET A 52 ? ? -174.86 35.40 81 4 LYS A 71 ? ? -142.52 -84.83 82 4 LYS A 74 ? ? -160.53 116.16 83 4 ASP A 76 ? ? 61.00 -86.50 84 4 PHE A 81 ? ? -154.45 69.86 85 5 HIS A 4 ? ? -135.58 -73.02 86 5 GLU A 9 ? ? -122.93 -68.26 87 5 ALA A 14 ? ? -175.20 129.94 88 5 GLN A 15 ? ? 41.33 83.34 89 5 LYS A 16 ? ? 71.81 -24.02 90 5 SER A 17 ? ? 59.88 1.02 91 5 MET A 19 ? ? -155.77 -30.62 92 5 LYS A 23 ? ? 69.40 88.74 93 5 GLU A 26 ? ? -108.00 -79.86 94 5 ALA A 28 ? ? 61.55 -169.87 95 5 GLN A 36 ? ? 177.35 -72.31 96 5 GLU A 38 ? ? -146.17 -64.58 97 5 LYS A 41 ? ? 76.68 -154.99 98 5 LYS A 42 ? ? 78.90 -44.14 99 5 ALA A 43 ? ? -59.58 -72.13 100 5 MET A 44 ? ? 178.99 -32.78 101 5 SER A 45 ? ? 60.84 -80.11 102 5 CYS A 51 ? ? -170.07 -76.25 103 5 MET A 52 ? ? -179.89 60.86 104 5 SER A 60 ? ? -75.75 20.42 105 5 GLU A 61 ? ? 65.23 -52.22 106 5 LYS A 71 ? ? -128.16 -76.13 107 5 HIS A 72 ? ? 39.13 60.62 108 5 LYS A 74 ? ? -162.28 -32.03 109 5 ALA A 75 ? ? 71.45 116.53 110 5 ASP A 76 ? ? -104.21 -80.87 111 5 PHE A 81 ? ? -168.12 84.10 112 5 PRO A 82 ? ? -62.14 5.97 113 6 HIS A 2 ? ? 78.78 123.26 114 6 HIS A 4 ? ? -163.59 102.75 115 6 HIS A 6 ? ? 69.21 116.25 116 6 HIS A 7 ? ? -176.39 21.86 117 6 GLU A 9 ? ? 66.19 99.07 118 6 ASN A 13 ? ? 71.38 163.81 119 6 SER A 17 ? ? 71.17 -35.25 120 6 ASN A 24 ? ? -146.38 -29.51 121 6 GLU A 26 ? ? -79.24 -72.40 122 6 ALA A 31 ? ? -104.26 -74.83 123 6 ALA A 39 ? ? -167.91 -55.20 124 6 LYS A 42 ? ? 73.29 125.89 125 6 SER A 45 ? ? 48.25 -101.10 126 6 CYS A 51 ? ? -159.96 -67.26 127 6 MET A 52 ? ? 178.21 60.24 128 6 GLU A 61 ? ? 67.58 -64.85 129 6 LYS A 71 ? ? -131.39 -79.07 130 6 LYS A 74 ? ? -163.69 106.86 131 6 ASP A 76 ? ? -107.01 -87.62 132 6 PHE A 81 ? ? -153.61 71.49 133 7 HIS A 6 ? ? -125.13 -156.22 134 7 LEU A 8 ? ? 74.51 88.00 135 7 LYS A 16 ? ? 167.58 -57.24 136 7 ARG A 21 ? ? -170.38 27.38 137 7 LYS A 23 ? ? 68.38 -4.37 138 7 LEU A 25 ? ? 63.40 -168.04 139 7 GLU A 26 ? ? -132.01 -50.24 140 7 LYS A 33 ? ? 72.00 -15.11 141 7 GLN A 36 ? ? -159.38 -85.80 142 7 SER A 45 ? ? 46.69 -98.55 143 7 CYS A 51 ? ? -159.01 -74.06 144 7 MET A 52 ? ? 176.38 40.64 145 7 LYS A 71 ? ? -135.43 -111.08 146 7 HIS A 72 ? ? 29.23 51.62 147 7 LYS A 74 ? ? -161.45 109.30 148 7 ASP A 76 ? ? -98.95 -90.65 149 7 PHE A 81 ? ? -154.10 70.60 150 7 LYS A 85 ? ? -53.92 -83.38 151 8 LEU A 8 ? ? 62.46 -174.65 152 8 LYS A 16 ? ? 79.02 -31.69 153 8 SER A 17 ? ? 70.92 -38.34 154 8 LYS A 23 ? ? -136.55 -90.67 155 8 ASN A 24 ? ? 58.87 -71.42 156 8 GLN A 36 ? ? -126.15 -67.05 157 8 GLU A 38 ? ? 52.79 -168.78 158 8 ALA A 39 ? ? 71.70 -17.28 159 8 LYS A 41 ? ? -131.26 -74.72 160 8 LYS A 42 ? ? 64.40 -33.63 161 8 MET A 44 ? ? 61.42 90.04 162 8 SER A 45 ? ? -60.00 -81.86 163 8 CYS A 51 ? ? -160.02 -71.23 164 8 MET A 52 ? ? -178.95 28.12 165 8 LYS A 71 ? ? -138.19 -73.99 166 8 ASP A 76 ? ? -113.98 -72.48 167 8 PHE A 81 ? ? -151.69 75.27 168 8 PRO A 82 ? ? -67.88 9.44 169 9 HIS A 3 ? ? 71.98 131.00 170 9 HIS A 6 ? ? 72.98 178.70 171 9 ASN A 13 ? ? 65.52 -172.73 172 9 SER A 17 ? ? -57.22 -5.62 173 9 LYS A 23 ? ? 67.11 117.46 174 9 LEU A 25 ? ? 59.10 85.07 175 9 LYS A 27 ? ? -127.81 -73.49 176 9 GLN A 36 ? ? -121.15 -76.26 177 9 GLU A 38 ? ? 59.59 94.54 178 9 ALA A 39 ? ? -158.07 -46.77 179 9 MET A 44 ? ? 56.27 78.02 180 9 SER A 45 ? ? -61.26 -72.52 181 9 CYS A 51 ? ? -173.63 -81.93 182 9 MET A 52 ? ? -165.50 36.73 183 9 LYS A 71 ? ? -101.45 -86.54 184 9 LYS A 74 ? ? -160.84 108.82 185 9 ASP A 76 ? ? -113.19 -75.24 186 9 PHE A 81 ? ? -155.02 88.22 187 9 PRO A 82 ? ? -60.60 5.49 188 9 LYS A 85 ? ? -50.65 105.74 189 10 LEU A 8 ? ? 82.59 -17.08 190 10 GLN A 15 ? ? 71.75 173.23 191 10 LYS A 16 ? ? 75.32 -56.67 192 10 ARG A 21 ? ? -178.20 83.71 193 10 ALA A 22 ? ? -63.53 -82.83 194 10 LEU A 25 ? ? -120.18 -79.03 195 10 GLU A 26 ? ? 52.24 95.07 196 10 LYS A 27 ? ? 70.37 102.16 197 10 LYS A 33 ? ? -147.71 31.95 198 10 SER A 35 ? ? 174.47 -40.09 199 10 GLU A 38 ? ? 66.95 118.50 200 10 LYS A 41 ? ? -96.44 33.92 201 10 ALA A 43 ? ? 176.62 -20.28 202 10 SER A 45 ? ? -143.89 -73.04 203 10 CYS A 51 ? ? -161.86 -76.72 204 10 MET A 52 ? ? 178.51 35.75 205 10 THR A 59 ? ? -109.09 -155.44 206 10 GLU A 61 ? ? 64.78 -50.88 207 10 LYS A 71 ? ? -136.00 -85.87 208 10 LYS A 74 ? ? -167.49 106.23 209 10 ASP A 76 ? ? 56.43 -94.73 210 10 PHE A 81 ? ? -167.78 83.37 211 10 PRO A 82 ? ? -63.07 11.26 212 11 HIS A 4 ? ? 68.05 83.63 213 11 HIS A 6 ? ? 35.53 92.27 214 11 ASN A 13 ? ? 71.05 175.09 215 11 ALA A 14 ? ? -147.85 26.89 216 11 GLN A 15 ? ? 71.00 -64.33 217 11 ARG A 21 ? ? -101.76 -60.28 218 11 ALA A 22 ? ? 67.59 -54.69 219 11 LYS A 23 ? ? -98.17 -72.99 220 11 ASN A 24 ? ? 47.80 -174.32 221 11 LYS A 27 ? ? -117.65 -83.67 222 11 LEU A 37 ? ? 69.63 -59.25 223 11 MET A 44 ? ? 75.33 -3.85 224 11 SER A 45 ? ? 48.02 -98.74 225 11 CYS A 51 ? ? -170.72 -77.50 226 11 MET A 52 ? ? -171.51 39.85 227 11 GLU A 61 ? ? 63.10 -61.67 228 11 LYS A 71 ? ? -144.17 -85.56 229 11 LYS A 74 ? ? -171.86 -40.41 230 11 ALA A 75 ? ? 76.03 108.66 231 11 ASP A 76 ? ? -87.47 -105.58 232 11 PRO A 82 ? ? -62.04 5.13 233 12 HIS A 2 ? ? 73.14 127.52 234 12 HIS A 3 ? ? 74.98 -168.01 235 12 LEU A 8 ? ? 68.56 -64.64 236 12 GLU A 9 ? ? -75.61 21.35 237 12 GLN A 15 ? ? 64.23 169.23 238 12 LYS A 23 ? ? 71.13 -38.68 239 12 ASN A 24 ? ? -57.09 -74.79 240 12 LEU A 25 ? ? -115.42 -83.06 241 12 GLN A 36 ? ? -171.20 105.18 242 12 LEU A 37 ? ? 68.52 -78.36 243 12 GLU A 38 ? ? 53.61 83.43 244 12 ASN A 40 ? ? 64.98 -175.06 245 12 MET A 44 ? ? 62.21 74.55 246 12 CYS A 51 ? ? -161.17 -77.62 247 12 MET A 52 ? ? -178.24 36.55 248 12 THR A 58 ? ? -56.17 1.69 249 12 LYS A 71 ? ? -88.05 -77.54 250 12 ASP A 76 ? ? -95.19 -91.82 251 12 PRO A 82 ? ? -69.03 7.45 252 13 HIS A 3 ? ? 80.70 146.62 253 13 HIS A 6 ? ? 75.78 112.04 254 13 LEU A 8 ? ? 69.82 -78.83 255 13 ASN A 13 ? ? 59.20 -179.20 256 13 ALA A 14 ? ? -151.12 57.74 257 13 GLN A 15 ? ? 64.12 -87.20 258 13 SER A 17 ? ? -81.54 32.05 259 13 ASN A 24 ? ? -141.04 -70.76 260 13 LEU A 25 ? ? -96.76 -83.27 261 13 GLN A 36 ? ? -138.84 -48.27 262 13 GLU A 38 ? ? 67.46 92.88 263 13 LYS A 42 ? ? 65.32 -59.85 264 13 MET A 44 ? ? 60.11 -23.36 265 13 SER A 45 ? ? 70.47 -101.07 266 13 CYS A 51 ? ? -172.11 -86.27 267 13 MET A 52 ? ? -164.68 40.51 268 13 GLU A 61 ? ? 64.04 -62.16 269 13 LYS A 71 ? ? -141.04 -83.67 270 13 ASP A 76 ? ? -96.95 -90.55 271 13 PRO A 82 ? ? -63.49 8.40 272 14 HIS A 2 ? ? 69.94 -52.27 273 14 LEU A 8 ? ? 69.80 -72.61 274 14 ASN A 13 ? ? 65.72 -76.74 275 14 ALA A 14 ? ? 58.53 176.34 276 14 SER A 17 ? ? 67.47 -41.61 277 14 ALA A 30 ? ? 57.02 -152.34 278 14 SER A 35 ? ? -89.70 -79.49 279 14 GLN A 36 ? ? -134.74 -64.10 280 14 LYS A 41 ? ? -137.07 -56.55 281 14 LYS A 42 ? ? 68.91 -47.30 282 14 MET A 44 ? ? 57.24 87.68 283 14 SER A 45 ? ? -75.48 -84.35 284 14 CYS A 51 ? ? -176.96 -110.57 285 14 GLN A 53 ? ? -106.25 -165.05 286 14 THR A 59 ? ? -143.79 -89.57 287 14 SER A 60 ? ? -173.06 5.03 288 14 GLU A 61 ? ? 67.75 -45.58 289 14 LYS A 71 ? ? -146.00 -82.89 290 14 HIS A 72 ? ? 36.45 67.24 291 14 ASP A 76 ? ? -95.53 -87.10 292 14 PHE A 81 ? ? -161.93 80.13 293 15 HIS A 3 ? ? -142.92 18.36 294 15 HIS A 6 ? ? 73.63 101.16 295 15 GLU A 9 ? ? -162.61 -61.26 296 15 GLN A 15 ? ? 62.80 97.50 297 15 GLN A 36 ? ? -160.21 -59.53 298 15 GLU A 38 ? ? 70.73 -39.45 299 15 LYS A 41 ? ? 66.66 86.65 300 15 SER A 45 ? ? 55.60 -108.20 301 15 CYS A 51 ? ? -174.27 -99.84 302 15 GLU A 61 ? ? 64.96 -60.69 303 15 LYS A 71 ? ? -137.67 -81.90 304 15 LYS A 74 ? ? -177.39 -23.40 305 15 ALA A 75 ? ? 74.69 103.08 306 15 ASP A 76 ? ? -100.18 -85.66 307 15 PHE A 81 ? ? -165.86 83.57 308 15 PRO A 82 ? ? -58.08 1.73 309 15 LYS A 85 ? ? 41.88 166.53 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Center for Eukaryotic Structural Genomics' _pdbx_SG_project.initial_of_center CESG # _pdbx_nmr_ensemble.entry_id 1WVK _pdbx_nmr_ensemble.conformers_calculated_total_number 15 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WVK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM At2g23090 U-13C, U-15N; 10mM Bis-Tris buffer, 100mM NaCl, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '10% D2O, 90% H2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1WVK _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics, matrix relaxation, torsion angle dynamics, water refinement' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal ARIA 1.2 'structure solution' 'Nilges, M.' 1 ARIA 1.2 refinement 'Nilges, M.' 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 VAL N N N N 318 VAL CA C N S 319 VAL C C N N 320 VAL O O N N 321 VAL CB C N N 322 VAL CG1 C N N 323 VAL CG2 C N N 324 VAL OXT O N N 325 VAL H H N N 326 VAL H2 H N N 327 VAL HA H N N 328 VAL HB H N N 329 VAL HG11 H N N 330 VAL HG12 H N N 331 VAL HG13 H N N 332 VAL HG21 H N N 333 VAL HG22 H N N 334 VAL HG23 H N N 335 VAL HXT H N N 336 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 VAL N CA sing N N 304 VAL N H sing N N 305 VAL N H2 sing N N 306 VAL CA C sing N N 307 VAL CA CB sing N N 308 VAL CA HA sing N N 309 VAL C O doub N N 310 VAL C OXT sing N N 311 VAL CB CG1 sing N N 312 VAL CB CG2 sing N N 313 VAL CB HB sing N N 314 VAL CG1 HG11 sing N N 315 VAL CG1 HG12 sing N N 316 VAL CG1 HG13 sing N N 317 VAL CG2 HG21 sing N N 318 VAL CG2 HG22 sing N N 319 VAL CG2 HG23 sing N N 320 VAL OXT HXT sing N N 321 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 900 2 ? Varian INOVA 600 # _atom_sites.entry_id 1WVK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_