data_1WVO # _entry.id 1WVO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WVO pdb_00001wvo 10.2210/pdb1wvo/pdb RCSB RCSB024056 ? ? WWPDB D_1000024056 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-03 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WVO _pdbx_database_status.recvd_initial_deposition_date 2004-12-22 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001002155.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ito, Y.' 1 'Hamada, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'Hirota, H.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the antifreeze-like domain of human sialic acid synthase' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 15 _citation.page_first 1010 _citation.page_last 1016 _citation.year 2006 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16597820 _citation.pdbx_database_id_DOI 10.1110/ps.051700406 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hamada, T.' 1 ? primary 'Ito, Y.' 2 ? primary 'Abe, T.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Guntert, P.' 5 ? primary 'Inoue, M.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Terada, T.' 8 ? primary 'Shirouzu, M.' 9 ? primary 'Yoshida, M.' 10 ? primary 'Tanaka, A.' 11 ? primary 'Sugano, S.' 12 ? primary 'Yokoyama, S.' 13 ? primary 'Hirota, H.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sialic acid synthase' _entity.formula_weight 8269.431 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec '2.5.1.56, 2.5.1.57' _entity.pdbx_mutation ? _entity.pdbx_fragment 'antifreeze protein like domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;N-acetylneuraminate synthase, N-acetylneuraminic acid synthase, N-acetylneuraminate-9-phosphate synthase, N-acetylneuraminic acid phosphate synthase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKSSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKSSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001002155.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 VAL n 1 10 VAL n 1 11 ALA n 1 12 LYS n 1 13 VAL n 1 14 LYS n 1 15 ILE n 1 16 PRO n 1 17 GLU n 1 18 GLY n 1 19 THR n 1 20 ILE n 1 21 LEU n 1 22 THR n 1 23 MET n 1 24 ASP n 1 25 MET n 1 26 LEU n 1 27 THR n 1 28 VAL n 1 29 LYS n 1 30 VAL n 1 31 GLY n 1 32 GLU n 1 33 PRO n 1 34 LYS n 1 35 GLY n 1 36 TYR n 1 37 PRO n 1 38 PRO n 1 39 GLU n 1 40 ASP n 1 41 ILE n 1 42 PHE n 1 43 ASN n 1 44 LEU n 1 45 VAL n 1 46 GLY n 1 47 LYS n 1 48 LYS n 1 49 VAL n 1 50 LEU n 1 51 VAL n 1 52 THR n 1 53 VAL n 1 54 GLU n 1 55 GLU n 1 56 ASP n 1 57 ASP n 1 58 THR n 1 59 ILE n 1 60 MET n 1 61 GLU n 1 62 GLU n 1 63 LEU n 1 64 VAL n 1 65 ASP n 1 66 ASN n 1 67 HIS n 1 68 GLY n 1 69 LYS n 1 70 LYS n 1 71 ILE n 1 72 LYS n 1 73 SER n 1 74 SER n 1 75 GLY n 1 76 PRO n 1 77 SER n 1 78 SER n 1 79 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040531-08 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLY 79 79 79 GLY GLY A . n # _cell.entry_id 1WVO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WVO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1WVO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WVO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WVO _struct.title 'Solution structure of RSGI RUH-029, an antifreeze protein like domain in human N-acetylneuraminic acid phosphate synthase gene.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WVO _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;Antifreeze protein like domain, N-Acetylneuraminic acid phosphate synthase, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SIAS_HUMAN _struct_ref.pdbx_db_accession Q9NR45 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS _struct_ref.pdbx_align_begin 294 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WVO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NR45 _struct_ref_seq.db_align_beg 294 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WVO GLY A 1 ? UNP Q9NR45 ? ? 'cloning artifact' 1 1 1 1WVO SER A 2 ? UNP Q9NR45 ? ? 'cloning artifact' 2 2 1 1WVO SER A 3 ? UNP Q9NR45 ? ? 'cloning artifact' 3 3 1 1WVO GLY A 4 ? UNP Q9NR45 ? ? 'cloning artifact' 4 4 1 1WVO SER A 5 ? UNP Q9NR45 ? ? 'cloning artifact' 5 5 1 1WVO SER A 6 ? UNP Q9NR45 ? ? 'cloning artifact' 6 6 1 1WVO GLY A 7 ? UNP Q9NR45 ? ? 'cloning artifact' 7 7 1 1WVO SER A 74 ? UNP Q9NR45 ? ? 'cloning artifact' 74 8 1 1WVO GLY A 75 ? UNP Q9NR45 ? ? 'cloning artifact' 75 9 1 1WVO PRO A 76 ? UNP Q9NR45 ? ? 'cloning artifact' 76 10 1 1WVO SER A 77 ? UNP Q9NR45 ? ? 'cloning artifact' 77 11 1 1WVO SER A 78 ? UNP Q9NR45 ? ? 'cloning artifact' 78 12 1 1WVO GLY A 79 ? UNP Q9NR45 ? ? 'cloning artifact' 79 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 22 ? ASP A 24 ? THR A 22 ASP A 24 5 ? 3 HELX_P HELX_P2 2 ASP A 40 ? VAL A 45 ? ASP A 40 VAL A 45 1 ? 6 HELX_P HELX_P3 3 MET A 60 ? VAL A 64 ? MET A 60 VAL A 64 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 8 ? ALA A 11 ? SER A 8 ALA A 11 A 2 LEU A 26 ? LYS A 29 ? LEU A 26 LYS A 29 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id SER _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 8 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id SER _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 8 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 29 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -75.04 41.00 2 1 PRO A 33 ? ? -80.47 44.02 3 1 VAL A 45 ? ? -67.20 93.73 4 1 ASP A 56 ? ? 56.92 13.06 5 1 LYS A 69 ? ? -99.14 -65.03 6 1 ILE A 71 ? ? -74.93 39.60 7 2 SER A 77 ? ? -104.30 -122.90 8 3 VAL A 30 ? ? -59.63 98.62 9 3 VAL A 45 ? ? -67.68 91.29 10 4 GLU A 62 ? ? -65.66 4.33 11 4 ASN A 66 ? ? 179.73 135.55 12 5 HIS A 67 ? ? 64.43 -67.28 13 5 LYS A 69 ? ? 154.68 -4.48 14 5 SER A 73 ? ? -62.40 92.87 15 5 SER A 78 ? ? -154.62 80.34 16 6 SER A 5 ? ? -140.79 24.92 17 6 VAL A 45 ? ? -60.78 98.70 18 7 SER A 2 ? ? -131.41 -67.12 19 7 SER A 5 ? ? -153.97 79.44 20 7 PRO A 33 ? ? -73.30 31.65 21 7 HIS A 67 ? ? -63.63 94.34 22 7 SER A 74 ? ? -170.23 -170.70 23 8 SER A 6 ? ? -102.83 -105.42 24 8 ASP A 56 ? ? 82.87 1.20 25 8 ASN A 66 ? ? 173.18 114.94 26 8 SER A 73 ? ? -75.47 -168.36 27 9 SER A 5 ? ? -161.46 -68.11 28 9 LYS A 70 ? ? -59.08 109.38 29 9 SER A 73 ? ? -78.60 -77.70 30 9 PRO A 76 ? ? -68.88 9.65 31 9 SER A 78 ? ? -169.92 -26.01 32 10 PRO A 33 ? ? -77.80 28.80 33 10 ASP A 56 ? ? 72.47 -6.18 34 10 ILE A 59 ? ? -67.26 93.73 35 11 SER A 5 ? ? -171.71 127.91 36 12 SER A 2 ? ? -148.32 -48.69 37 12 LYS A 34 ? ? -48.54 106.15 38 12 HIS A 67 ? ? -147.20 -55.72 39 12 LYS A 69 ? ? -135.58 -57.36 40 12 PRO A 76 ? ? -67.73 15.36 41 13 VAL A 30 ? ? -66.99 89.99 42 13 SER A 78 ? ? -79.12 -167.57 43 14 LYS A 34 ? ? -67.47 95.32 44 14 ASP A 56 ? ? 58.63 8.29 45 15 SER A 2 ? ? -54.09 -71.18 46 15 LYS A 70 ? ? -161.67 105.98 47 15 SER A 73 ? ? -123.38 -67.64 48 15 SER A 77 ? ? -73.79 48.86 49 16 PRO A 33 ? ? -73.82 36.23 50 16 VAL A 45 ? ? -68.05 99.19 51 16 LYS A 69 ? ? -125.89 -77.20 52 16 SER A 73 ? ? -57.40 104.43 53 17 ASP A 56 ? ? 69.63 -1.07 54 17 LYS A 69 ? ? -157.01 -24.91 55 17 SER A 77 ? ? -152.30 35.67 56 18 SER A 2 ? ? -67.99 -178.64 57 18 PRO A 33 ? ? -66.46 13.02 58 19 LYS A 69 ? ? -72.22 38.21 59 19 LYS A 72 ? ? -131.77 -78.32 60 20 SER A 6 ? ? 166.50 160.35 61 20 LYS A 34 ? ? -68.63 92.91 62 20 ASP A 56 ? ? 59.23 11.58 63 20 LYS A 69 ? ? -116.79 50.14 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 36 ? ? 0.066 'SIDE CHAIN' 2 10 TYR A 36 ? ? 0.071 'SIDE CHAIN' 3 11 TYR A 36 ? ? 0.070 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1WVO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WVO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.1mM antifreeze protein like domain U-15N,13C; 20mM Tris-HCl buffer (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_details.entry_id 1WVO _pdbx_nmr_details.text 'This structure was determined using 3D NMR techniques' # _pdbx_nmr_refine.entry_id 1WVO _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1c collection Varian 1 NMRPipe 21_2 collection 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B. A.' 3 KUJIRA 0.9049 'structure solution' 'Kobayashi, N.' 4 CYANA 2.0.17 'structure solution' 'Guentert, P.' 5 CYANA 2.0.17 refinement 'Guentert, P.' 6 OPALp 1.4 refinement 'KORADI, R., BILLETER, M., GUNTERT, P.' 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLU N N N N 47 GLU CA C N S 48 GLU C C N N 49 GLU O O N N 50 GLU CB C N N 51 GLU CG C N N 52 GLU CD C N N 53 GLU OE1 O N N 54 GLU OE2 O N N 55 GLU OXT O N N 56 GLU H H N N 57 GLU H2 H N N 58 GLU HA H N N 59 GLU HB2 H N N 60 GLU HB3 H N N 61 GLU HG2 H N N 62 GLU HG3 H N N 63 GLU HE2 H N N 64 GLU HXT H N N 65 GLY N N N N 66 GLY CA C N N 67 GLY C C N N 68 GLY O O N N 69 GLY OXT O N N 70 GLY H H N N 71 GLY H2 H N N 72 GLY HA2 H N N 73 GLY HA3 H N N 74 GLY HXT H N N 75 HIS N N N N 76 HIS CA C N S 77 HIS C C N N 78 HIS O O N N 79 HIS CB C N N 80 HIS CG C Y N 81 HIS ND1 N Y N 82 HIS CD2 C Y N 83 HIS CE1 C Y N 84 HIS NE2 N Y N 85 HIS OXT O N N 86 HIS H H N N 87 HIS H2 H N N 88 HIS HA H N N 89 HIS HB2 H N N 90 HIS HB3 H N N 91 HIS HD1 H N N 92 HIS HD2 H N N 93 HIS HE1 H N N 94 HIS HE2 H N N 95 HIS HXT H N N 96 ILE N N N N 97 ILE CA C N S 98 ILE C C N N 99 ILE O O N N 100 ILE CB C N S 101 ILE CG1 C N N 102 ILE CG2 C N N 103 ILE CD1 C N N 104 ILE OXT O N N 105 ILE H H N N 106 ILE H2 H N N 107 ILE HA H N N 108 ILE HB H N N 109 ILE HG12 H N N 110 ILE HG13 H N N 111 ILE HG21 H N N 112 ILE HG22 H N N 113 ILE HG23 H N N 114 ILE HD11 H N N 115 ILE HD12 H N N 116 ILE HD13 H N N 117 ILE HXT H N N 118 LEU N N N N 119 LEU CA C N S 120 LEU C C N N 121 LEU O O N N 122 LEU CB C N N 123 LEU CG C N N 124 LEU CD1 C N N 125 LEU CD2 C N N 126 LEU OXT O N N 127 LEU H H N N 128 LEU H2 H N N 129 LEU HA H N N 130 LEU HB2 H N N 131 LEU HB3 H N N 132 LEU HG H N N 133 LEU HD11 H N N 134 LEU HD12 H N N 135 LEU HD13 H N N 136 LEU HD21 H N N 137 LEU HD22 H N N 138 LEU HD23 H N N 139 LEU HXT H N N 140 LYS N N N N 141 LYS CA C N S 142 LYS C C N N 143 LYS O O N N 144 LYS CB C N N 145 LYS CG C N N 146 LYS CD C N N 147 LYS CE C N N 148 LYS NZ N N N 149 LYS OXT O N N 150 LYS H H N N 151 LYS H2 H N N 152 LYS HA H N N 153 LYS HB2 H N N 154 LYS HB3 H N N 155 LYS HG2 H N N 156 LYS HG3 H N N 157 LYS HD2 H N N 158 LYS HD3 H N N 159 LYS HE2 H N N 160 LYS HE3 H N N 161 LYS HZ1 H N N 162 LYS HZ2 H N N 163 LYS HZ3 H N N 164 LYS HXT H N N 165 MET N N N N 166 MET CA C N S 167 MET C C N N 168 MET O O N N 169 MET CB C N N 170 MET CG C N N 171 MET SD S N N 172 MET CE C N N 173 MET OXT O N N 174 MET H H N N 175 MET H2 H N N 176 MET HA H N N 177 MET HB2 H N N 178 MET HB3 H N N 179 MET HG2 H N N 180 MET HG3 H N N 181 MET HE1 H N N 182 MET HE2 H N N 183 MET HE3 H N N 184 MET HXT H N N 185 PHE N N N N 186 PHE CA C N S 187 PHE C C N N 188 PHE O O N N 189 PHE CB C N N 190 PHE CG C Y N 191 PHE CD1 C Y N 192 PHE CD2 C Y N 193 PHE CE1 C Y N 194 PHE CE2 C Y N 195 PHE CZ C Y N 196 PHE OXT O N N 197 PHE H H N N 198 PHE H2 H N N 199 PHE HA H N N 200 PHE HB2 H N N 201 PHE HB3 H N N 202 PHE HD1 H N N 203 PHE HD2 H N N 204 PHE HE1 H N N 205 PHE HE2 H N N 206 PHE HZ H N N 207 PHE HXT H N N 208 PRO N N N N 209 PRO CA C N S 210 PRO C C N N 211 PRO O O N N 212 PRO CB C N N 213 PRO CG C N N 214 PRO CD C N N 215 PRO OXT O N N 216 PRO H H N N 217 PRO HA H N N 218 PRO HB2 H N N 219 PRO HB3 H N N 220 PRO HG2 H N N 221 PRO HG3 H N N 222 PRO HD2 H N N 223 PRO HD3 H N N 224 PRO HXT H N N 225 SER N N N N 226 SER CA C N S 227 SER C C N N 228 SER O O N N 229 SER CB C N N 230 SER OG O N N 231 SER OXT O N N 232 SER H H N N 233 SER H2 H N N 234 SER HA H N N 235 SER HB2 H N N 236 SER HB3 H N N 237 SER HG H N N 238 SER HXT H N N 239 THR N N N N 240 THR CA C N S 241 THR C C N N 242 THR O O N N 243 THR CB C N R 244 THR OG1 O N N 245 THR CG2 C N N 246 THR OXT O N N 247 THR H H N N 248 THR H2 H N N 249 THR HA H N N 250 THR HB H N N 251 THR HG1 H N N 252 THR HG21 H N N 253 THR HG22 H N N 254 THR HG23 H N N 255 THR HXT H N N 256 TYR N N N N 257 TYR CA C N S 258 TYR C C N N 259 TYR O O N N 260 TYR CB C N N 261 TYR CG C Y N 262 TYR CD1 C Y N 263 TYR CD2 C Y N 264 TYR CE1 C Y N 265 TYR CE2 C Y N 266 TYR CZ C Y N 267 TYR OH O N N 268 TYR OXT O N N 269 TYR H H N N 270 TYR H2 H N N 271 TYR HA H N N 272 TYR HB2 H N N 273 TYR HB3 H N N 274 TYR HD1 H N N 275 TYR HD2 H N N 276 TYR HE1 H N N 277 TYR HE2 H N N 278 TYR HH H N N 279 TYR HXT H N N 280 VAL N N N N 281 VAL CA C N S 282 VAL C C N N 283 VAL O O N N 284 VAL CB C N N 285 VAL CG1 C N N 286 VAL CG2 C N N 287 VAL OXT O N N 288 VAL H H N N 289 VAL H2 H N N 290 VAL HA H N N 291 VAL HB H N N 292 VAL HG11 H N N 293 VAL HG12 H N N 294 VAL HG13 H N N 295 VAL HG21 H N N 296 VAL HG22 H N N 297 VAL HG23 H N N 298 VAL HXT H N N 299 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLU N CA sing N N 44 GLU N H sing N N 45 GLU N H2 sing N N 46 GLU CA C sing N N 47 GLU CA CB sing N N 48 GLU CA HA sing N N 49 GLU C O doub N N 50 GLU C OXT sing N N 51 GLU CB CG sing N N 52 GLU CB HB2 sing N N 53 GLU CB HB3 sing N N 54 GLU CG CD sing N N 55 GLU CG HG2 sing N N 56 GLU CG HG3 sing N N 57 GLU CD OE1 doub N N 58 GLU CD OE2 sing N N 59 GLU OE2 HE2 sing N N 60 GLU OXT HXT sing N N 61 GLY N CA sing N N 62 GLY N H sing N N 63 GLY N H2 sing N N 64 GLY CA C sing N N 65 GLY CA HA2 sing N N 66 GLY CA HA3 sing N N 67 GLY C O doub N N 68 GLY C OXT sing N N 69 GLY OXT HXT sing N N 70 HIS N CA sing N N 71 HIS N H sing N N 72 HIS N H2 sing N N 73 HIS CA C sing N N 74 HIS CA CB sing N N 75 HIS CA HA sing N N 76 HIS C O doub N N 77 HIS C OXT sing N N 78 HIS CB CG sing N N 79 HIS CB HB2 sing N N 80 HIS CB HB3 sing N N 81 HIS CG ND1 sing Y N 82 HIS CG CD2 doub Y N 83 HIS ND1 CE1 doub Y N 84 HIS ND1 HD1 sing N N 85 HIS CD2 NE2 sing Y N 86 HIS CD2 HD2 sing N N 87 HIS CE1 NE2 sing Y N 88 HIS CE1 HE1 sing N N 89 HIS NE2 HE2 sing N N 90 HIS OXT HXT sing N N 91 ILE N CA sing N N 92 ILE N H sing N N 93 ILE N H2 sing N N 94 ILE CA C sing N N 95 ILE CA CB sing N N 96 ILE CA HA sing N N 97 ILE C O doub N N 98 ILE C OXT sing N N 99 ILE CB CG1 sing N N 100 ILE CB CG2 sing N N 101 ILE CB HB sing N N 102 ILE CG1 CD1 sing N N 103 ILE CG1 HG12 sing N N 104 ILE CG1 HG13 sing N N 105 ILE CG2 HG21 sing N N 106 ILE CG2 HG22 sing N N 107 ILE CG2 HG23 sing N N 108 ILE CD1 HD11 sing N N 109 ILE CD1 HD12 sing N N 110 ILE CD1 HD13 sing N N 111 ILE OXT HXT sing N N 112 LEU N CA sing N N 113 LEU N H sing N N 114 LEU N H2 sing N N 115 LEU CA C sing N N 116 LEU CA CB sing N N 117 LEU CA HA sing N N 118 LEU C O doub N N 119 LEU C OXT sing N N 120 LEU CB CG sing N N 121 LEU CB HB2 sing N N 122 LEU CB HB3 sing N N 123 LEU CG CD1 sing N N 124 LEU CG CD2 sing N N 125 LEU CG HG sing N N 126 LEU CD1 HD11 sing N N 127 LEU CD1 HD12 sing N N 128 LEU CD1 HD13 sing N N 129 LEU CD2 HD21 sing N N 130 LEU CD2 HD22 sing N N 131 LEU CD2 HD23 sing N N 132 LEU OXT HXT sing N N 133 LYS N CA sing N N 134 LYS N H sing N N 135 LYS N H2 sing N N 136 LYS CA C sing N N 137 LYS CA CB sing N N 138 LYS CA HA sing N N 139 LYS C O doub N N 140 LYS C OXT sing N N 141 LYS CB CG sing N N 142 LYS CB HB2 sing N N 143 LYS CB HB3 sing N N 144 LYS CG CD sing N N 145 LYS CG HG2 sing N N 146 LYS CG HG3 sing N N 147 LYS CD CE sing N N 148 LYS CD HD2 sing N N 149 LYS CD HD3 sing N N 150 LYS CE NZ sing N N 151 LYS CE HE2 sing N N 152 LYS CE HE3 sing N N 153 LYS NZ HZ1 sing N N 154 LYS NZ HZ2 sing N N 155 LYS NZ HZ3 sing N N 156 LYS OXT HXT sing N N 157 MET N CA sing N N 158 MET N H sing N N 159 MET N H2 sing N N 160 MET CA C sing N N 161 MET CA CB sing N N 162 MET CA HA sing N N 163 MET C O doub N N 164 MET C OXT sing N N 165 MET CB CG sing N N 166 MET CB HB2 sing N N 167 MET CB HB3 sing N N 168 MET CG SD sing N N 169 MET CG HG2 sing N N 170 MET CG HG3 sing N N 171 MET SD CE sing N N 172 MET CE HE1 sing N N 173 MET CE HE2 sing N N 174 MET CE HE3 sing N N 175 MET OXT HXT sing N N 176 PHE N CA sing N N 177 PHE N H sing N N 178 PHE N H2 sing N N 179 PHE CA C sing N N 180 PHE CA CB sing N N 181 PHE CA HA sing N N 182 PHE C O doub N N 183 PHE C OXT sing N N 184 PHE CB CG sing N N 185 PHE CB HB2 sing N N 186 PHE CB HB3 sing N N 187 PHE CG CD1 doub Y N 188 PHE CG CD2 sing Y N 189 PHE CD1 CE1 sing Y N 190 PHE CD1 HD1 sing N N 191 PHE CD2 CE2 doub Y N 192 PHE CD2 HD2 sing N N 193 PHE CE1 CZ doub Y N 194 PHE CE1 HE1 sing N N 195 PHE CE2 CZ sing Y N 196 PHE CE2 HE2 sing N N 197 PHE CZ HZ sing N N 198 PHE OXT HXT sing N N 199 PRO N CA sing N N 200 PRO N CD sing N N 201 PRO N H sing N N 202 PRO CA C sing N N 203 PRO CA CB sing N N 204 PRO CA HA sing N N 205 PRO C O doub N N 206 PRO C OXT sing N N 207 PRO CB CG sing N N 208 PRO CB HB2 sing N N 209 PRO CB HB3 sing N N 210 PRO CG CD sing N N 211 PRO CG HG2 sing N N 212 PRO CG HG3 sing N N 213 PRO CD HD2 sing N N 214 PRO CD HD3 sing N N 215 PRO OXT HXT sing N N 216 SER N CA sing N N 217 SER N H sing N N 218 SER N H2 sing N N 219 SER CA C sing N N 220 SER CA CB sing N N 221 SER CA HA sing N N 222 SER C O doub N N 223 SER C OXT sing N N 224 SER CB OG sing N N 225 SER CB HB2 sing N N 226 SER CB HB3 sing N N 227 SER OG HG sing N N 228 SER OXT HXT sing N N 229 THR N CA sing N N 230 THR N H sing N N 231 THR N H2 sing N N 232 THR CA C sing N N 233 THR CA CB sing N N 234 THR CA HA sing N N 235 THR C O doub N N 236 THR C OXT sing N N 237 THR CB OG1 sing N N 238 THR CB CG2 sing N N 239 THR CB HB sing N N 240 THR OG1 HG1 sing N N 241 THR CG2 HG21 sing N N 242 THR CG2 HG22 sing N N 243 THR CG2 HG23 sing N N 244 THR OXT HXT sing N N 245 TYR N CA sing N N 246 TYR N H sing N N 247 TYR N H2 sing N N 248 TYR CA C sing N N 249 TYR CA CB sing N N 250 TYR CA HA sing N N 251 TYR C O doub N N 252 TYR C OXT sing N N 253 TYR CB CG sing N N 254 TYR CB HB2 sing N N 255 TYR CB HB3 sing N N 256 TYR CG CD1 doub Y N 257 TYR CG CD2 sing Y N 258 TYR CD1 CE1 sing Y N 259 TYR CD1 HD1 sing N N 260 TYR CD2 CE2 doub Y N 261 TYR CD2 HD2 sing N N 262 TYR CE1 CZ doub Y N 263 TYR CE1 HE1 sing N N 264 TYR CE2 CZ sing Y N 265 TYR CE2 HE2 sing N N 266 TYR CZ OH sing N N 267 TYR OH HH sing N N 268 TYR OXT HXT sing N N 269 VAL N CA sing N N 270 VAL N H sing N N 271 VAL N H2 sing N N 272 VAL CA C sing N N 273 VAL CA CB sing N N 274 VAL CA HA sing N N 275 VAL C O doub N N 276 VAL C OXT sing N N 277 VAL CB CG1 sing N N 278 VAL CB CG2 sing N N 279 VAL CB HB sing N N 280 VAL CG1 HG11 sing N N 281 VAL CG1 HG12 sing N N 282 VAL CG1 HG13 sing N N 283 VAL CG2 HG21 sing N N 284 VAL CG2 HG22 sing N N 285 VAL CG2 HG23 sing N N 286 VAL OXT HXT sing N N 287 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 800 # _atom_sites.entry_id 1WVO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_