data_1WWN # _entry.id 1WWN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WWN pdb_00001wwn 10.2210/pdb1wwn/pdb RCSB RCSB024088 ? ? WWPDB D_1000024088 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WWN _pdbx_database_status.recvd_initial_deposition_date 2005-01-10 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1BCG ;An excitatory scorpion toxin with a distinctive feature: an additional alpha helix at the C terminus and its implications for interaction with insect sodium channels ; unspecified PDB 1NPI 'Tityus Serrulatus Neurotoxin (Ts1) At Atomic Resolution' unspecified PDB 1PTX 'Crystal structure of toxin II from the scorpion Androctonus australis Hector refined at 1.3 A resolution' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, H.' 1 'Tong, X.' 2 'Chen, X.' 3 'Zhang, Q.' 4 'Zheng, X.' 5 'Zhang, N.' 6 'Wu, G.' 7 # _citation.id primary _citation.title ;NMR solution structure of BmK-betaIT, an excitatory scorpion beta-toxin without a 'hot spot' at the relevant position ; _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 349 _citation.page_first 890 _citation.page_last 899 _citation.year 2006 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16970911 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2006.08.131 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tong, X.' 1 ? primary 'Yao, J.' 2 ? primary 'He, F.' 3 ? primary 'Chen, X.' 4 ? primary 'Zheng, X.' 5 ? primary 'Xie, C.' 6 ? primary 'Wu, G.' 7 ? primary 'Zhang, N.' 8 ? primary 'Ding, J.' 9 ? primary 'Wu, H.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Excitatory insect selective toxin 1' _entity.formula_weight 7649.795 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BmK IT1, BmKIT1, BmK IT, BmKIT, Bm32-VI, neurotoxin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KKNGYAVDSSGKVSECLLNNYCNNICTKVYYATSGYCCLLSCYCFGLDDDKAVLKIKDATKSYCDVQII _entity_poly.pdbx_seq_one_letter_code_can KKNGYAVDSSGKVSECLLNNYCNNICTKVYYATSGYCCLLSCYCFGLDDDKAVLKIKDATKSYCDVQII _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LYS n 1 3 ASN n 1 4 GLY n 1 5 TYR n 1 6 ALA n 1 7 VAL n 1 8 ASP n 1 9 SER n 1 10 SER n 1 11 GLY n 1 12 LYS n 1 13 VAL n 1 14 SER n 1 15 GLU n 1 16 CYS n 1 17 LEU n 1 18 LEU n 1 19 ASN n 1 20 ASN n 1 21 TYR n 1 22 CYS n 1 23 ASN n 1 24 ASN n 1 25 ILE n 1 26 CYS n 1 27 THR n 1 28 LYS n 1 29 VAL n 1 30 TYR n 1 31 TYR n 1 32 ALA n 1 33 THR n 1 34 SER n 1 35 GLY n 1 36 TYR n 1 37 CYS n 1 38 CYS n 1 39 LEU n 1 40 LEU n 1 41 SER n 1 42 CYS n 1 43 TYR n 1 44 CYS n 1 45 PHE n 1 46 GLY n 1 47 LEU n 1 48 ASP n 1 49 ASP n 1 50 ASP n 1 51 LYS n 1 52 ALA n 1 53 VAL n 1 54 LEU n 1 55 LYS n 1 56 ILE n 1 57 LYS n 1 58 ASP n 1 59 ALA n 1 60 THR n 1 61 LYS n 1 62 SER n 1 63 TYR n 1 64 CYS n 1 65 ASP n 1 66 VAL n 1 67 GLN n 1 68 ILE n 1 69 ILE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Chinese scorpion' _entity_src_nat.pdbx_organism_scientific 'Mesobuthus martensii' _entity_src_nat.pdbx_ncbi_taxonomy_id 34649 _entity_src_nat.genus Mesobuthus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ILE 69 69 69 ILE ILE A . n # _exptl.entry_id 1WWN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1WWN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1WWN _struct.title 'NMR Solution Structure of BmK-betaIT, an Excitatory Scorpion Toxin from Buthus martensi Karsch' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WWN _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'An Excitatory Scorpion toxin, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SIX1_MESMA _struct_ref.pdbx_db_accession O61668 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KKNGYAVDSSGKVSECLLNNYCNNICTKVYYATSGYCCLLSCYCFGLDDDKAVLKIKDATKSYCDVQII _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WWN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O61668 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 87 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 69 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 18 ? VAL A 29 ? LEU A 18 VAL A 29 1 ? 12 HELX_P HELX_P2 2 LYS A 57 ? CYS A 64 ? LYS A 57 CYS A 64 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 16 A CYS 37 1_555 ? ? ? ? ? ? ? 2.089 ? ? disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 22 A CYS 42 1_555 ? ? ? ? ? ? ? 2.072 ? ? disulf3 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 26 A CYS 44 1_555 ? ? ? ? ? ? ? 2.045 ? ? disulf4 disulf ? ? A CYS 38 SG ? ? ? 1_555 A CYS 64 SG ? ? A CYS 38 A CYS 64 1_555 ? ? ? ? ? ? ? 2.076 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 16 ? CYS A 37 ? CYS A 16 ? 1_555 CYS A 37 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 22 ? CYS A 42 ? CYS A 22 ? 1_555 CYS A 42 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 26 ? CYS A 44 ? CYS A 26 ? 1_555 CYS A 44 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 38 ? CYS A 64 ? CYS A 38 ? 1_555 CYS A 64 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 3 ? TYR A 5 ? ASN A 3 TYR A 5 A 2 SER A 41 ? PHE A 45 ? SER A 41 PHE A 45 A 3 SER A 34 ? CYS A 38 ? SER A 34 CYS A 38 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 4 ? N GLY A 4 O CYS A 44 ? O CYS A 44 A 2 3 O TYR A 43 ? O TYR A 43 N TYR A 36 ? N TYR A 36 # _pdbx_entry_details.entry_id 1WWN _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 43 ? ? CG A TYR 43 ? ? CD2 A TYR 43 ? ? 117.12 121.00 -3.88 0.60 N 2 2 CB A TYR 5 ? ? CG A TYR 5 ? ? CD2 A TYR 5 ? ? 116.69 121.00 -4.31 0.60 N 3 2 CA A CYS 44 ? ? CB A CYS 44 ? ? SG A CYS 44 ? ? 122.53 114.20 8.33 1.10 N 4 3 CA A CYS 44 ? ? CB A CYS 44 ? ? SG A CYS 44 ? ? 121.35 114.20 7.15 1.10 N 5 3 CB A LEU 47 ? ? CG A LEU 47 ? ? CD2 A LEU 47 ? ? 124.38 111.00 13.38 1.70 N 6 6 CA A CYS 44 ? ? CB A CYS 44 ? ? SG A CYS 44 ? ? 122.11 114.20 7.91 1.10 N 7 9 CA A CYS 44 ? ? CB A CYS 44 ? ? SG A CYS 44 ? ? 121.33 114.20 7.13 1.10 N 8 12 CA A CYS 16 ? ? CB A CYS 16 ? ? SG A CYS 16 ? ? 121.58 114.20 7.38 1.10 N 9 15 CA A LYS 61 ? ? CB A LYS 61 ? ? CG A LYS 61 ? ? 129.00 113.40 15.60 2.20 N 10 16 CB A TYR 5 ? ? CG A TYR 5 ? ? CD2 A TYR 5 ? ? 115.82 121.00 -5.18 0.60 N 11 16 CA A CYS 44 ? ? CB A CYS 44 ? ? SG A CYS 44 ? ? 121.20 114.20 7.00 1.10 N 12 17 CB A TYR 5 ? ? CG A TYR 5 ? ? CD2 A TYR 5 ? ? 117.24 121.00 -3.76 0.60 N 13 20 CB A LEU 47 ? ? CG A LEU 47 ? ? CD1 A LEU 47 ? ? 123.18 111.00 12.18 1.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -130.28 -158.89 2 1 SER A 9 ? ? -141.99 -12.35 3 1 SER A 10 ? ? -163.87 52.22 4 1 GLU A 15 ? ? 46.71 -120.65 5 1 CYS A 16 ? ? 111.96 66.54 6 1 TYR A 31 ? ? 74.34 31.43 7 1 ALA A 32 ? ? -48.41 160.53 8 1 CYS A 37 ? ? -69.41 92.62 9 1 LEU A 39 ? ? -16.21 -54.74 10 1 LEU A 40 ? ? -143.14 24.60 11 1 CYS A 42 ? ? -59.78 109.79 12 1 LEU A 47 ? ? -28.86 108.07 13 1 ALA A 52 ? ? 168.45 56.05 14 1 ASP A 65 ? ? -96.76 -69.28 15 1 GLN A 67 ? ? -24.63 -61.10 16 2 LYS A 2 ? ? -102.19 -149.53 17 2 ASN A 3 ? ? -49.12 152.71 18 2 ASP A 8 ? ? -77.76 -117.58 19 2 SER A 10 ? ? 85.47 68.10 20 2 CYS A 16 ? ? 56.91 -179.51 21 2 LEU A 17 ? ? -130.21 -46.53 22 2 TYR A 31 ? ? 83.62 51.10 23 2 ALA A 32 ? ? -78.37 -167.28 24 2 SER A 34 ? ? -114.78 -162.73 25 2 LEU A 39 ? ? -7.99 -57.37 26 2 LEU A 40 ? ? -152.52 39.83 27 2 ASP A 48 ? ? -96.16 -71.22 28 2 ALA A 52 ? ? 42.07 70.83 29 2 GLN A 67 ? ? -43.42 -70.35 30 2 ILE A 68 ? ? -93.38 -62.20 31 3 LYS A 2 ? ? -88.06 -155.68 32 3 SER A 9 ? ? -162.65 -47.01 33 3 GLU A 15 ? ? -36.46 -84.84 34 3 CYS A 16 ? ? 73.17 162.50 35 3 ASN A 19 ? ? -6.77 -64.71 36 3 LEU A 39 ? ? -5.58 -62.37 37 3 LEU A 40 ? ? -154.29 44.89 38 3 LEU A 47 ? ? -62.39 75.04 39 3 ASP A 50 ? ? 69.65 88.66 40 3 ALA A 52 ? ? 175.14 59.74 41 3 ASP A 65 ? ? -128.88 -55.60 42 3 GLN A 67 ? ? -19.72 -66.76 43 4 LYS A 2 ? ? -163.58 -84.97 44 4 ASP A 8 ? ? -22.18 -109.50 45 4 SER A 10 ? ? -154.22 -66.36 46 4 LYS A 12 ? ? -24.27 127.88 47 4 CYS A 16 ? ? 161.03 -178.16 48 4 LEU A 39 ? ? -13.59 -57.93 49 4 LEU A 40 ? ? -150.76 48.50 50 4 SER A 41 ? ? -168.74 -169.92 51 4 ASP A 48 ? ? -67.24 -160.24 52 4 ASP A 49 ? ? -66.56 -171.35 53 4 ASP A 65 ? ? -118.37 -76.99 54 4 GLN A 67 ? ? -19.98 -64.85 55 5 ASP A 8 ? ? -15.27 -76.70 56 5 SER A 9 ? ? 164.38 -44.30 57 5 CYS A 16 ? ? 73.58 99.89 58 5 VAL A 29 ? ? -98.04 -62.90 59 5 SER A 34 ? ? -174.00 -165.47 60 5 LEU A 39 ? ? -22.98 -46.32 61 5 LEU A 40 ? ? -149.59 32.96 62 5 ASP A 50 ? ? 45.44 81.46 63 5 VAL A 53 ? ? -38.06 128.67 64 5 ASP A 65 ? ? -125.70 -59.63 65 5 GLN A 67 ? ? -20.43 -67.61 66 6 ASN A 3 ? ? -35.65 117.19 67 6 ASP A 8 ? ? -85.89 -158.05 68 6 SER A 9 ? ? -72.91 48.54 69 6 SER A 10 ? ? -165.87 -53.77 70 6 LYS A 12 ? ? -66.28 81.59 71 6 CYS A 16 ? ? 56.94 178.40 72 6 LEU A 17 ? ? -131.98 -50.20 73 6 ASN A 19 ? ? -18.79 -50.62 74 6 TYR A 31 ? ? 82.97 31.85 75 6 SER A 34 ? ? -167.48 -157.11 76 6 LEU A 39 ? ? -39.67 -21.49 77 6 LEU A 40 ? ? -156.02 22.10 78 6 SER A 41 ? ? -173.44 -173.81 79 6 ASP A 48 ? ? -133.16 -51.22 80 6 ALA A 52 ? ? -177.91 57.96 81 6 ASP A 65 ? ? -137.71 -51.37 82 6 GLN A 67 ? ? -20.35 -66.54 83 7 CYS A 16 ? ? 160.96 174.90 84 7 ALA A 32 ? ? -62.71 -173.68 85 7 THR A 33 ? ? -108.01 -93.10 86 7 LEU A 39 ? ? 0.44 -64.08 87 7 LEU A 40 ? ? -156.38 39.36 88 7 ASP A 48 ? ? -92.12 -76.26 89 7 ALA A 52 ? ? 38.25 55.95 90 7 ASP A 65 ? ? -139.59 -60.57 91 7 GLN A 67 ? ? -22.48 -63.16 92 8 SER A 9 ? ? -74.51 47.79 93 8 SER A 10 ? ? -135.20 -58.60 94 8 CYS A 16 ? ? 155.15 169.56 95 8 ASN A 19 ? ? -27.06 -45.98 96 8 THR A 33 ? ? -129.79 -83.76 97 8 LEU A 39 ? ? -9.05 -62.07 98 8 LEU A 47 ? ? -32.80 101.44 99 8 LYS A 51 ? ? -10.57 -64.88 100 8 ALA A 52 ? ? -161.51 54.05 101 8 CYS A 64 ? ? -109.64 40.09 102 8 ASP A 65 ? ? -133.79 -53.53 103 8 GLN A 67 ? ? -17.39 -61.08 104 9 LYS A 2 ? ? -158.50 -157.86 105 9 ASP A 8 ? ? -93.72 -152.97 106 9 SER A 9 ? ? -68.83 48.12 107 9 SER A 10 ? ? -141.09 -49.48 108 9 GLU A 15 ? ? -70.18 -71.16 109 9 CYS A 16 ? ? 59.77 178.31 110 9 THR A 33 ? ? -97.07 -91.22 111 9 LEU A 39 ? ? -9.70 -57.19 112 9 LEU A 40 ? ? -152.41 47.47 113 9 ASP A 48 ? ? -108.52 -62.45 114 9 ALA A 52 ? ? -174.94 109.14 115 9 ASP A 65 ? ? -124.86 -52.25 116 9 GLN A 67 ? ? -20.40 -71.03 117 10 ASN A 3 ? ? 58.34 98.99 118 10 SER A 9 ? ? -168.27 36.55 119 10 SER A 10 ? ? -162.61 -73.11 120 10 CYS A 16 ? ? 157.69 175.29 121 10 ASN A 19 ? ? -7.56 -56.57 122 10 LEU A 39 ? ? -3.98 -55.92 123 10 LEU A 40 ? ? -154.23 29.87 124 10 ALA A 52 ? ? -173.38 64.31 125 10 ASP A 65 ? ? -100.32 -73.55 126 10 GLN A 67 ? ? -28.61 -67.29 127 11 LYS A 2 ? ? -116.97 -162.72 128 11 ASP A 8 ? ? -1.08 -77.92 129 11 SER A 9 ? ? 174.92 -42.04 130 11 GLU A 15 ? ? -33.01 -82.20 131 11 CYS A 16 ? ? 71.84 166.99 132 11 ASN A 19 ? ? -12.52 -56.61 133 11 LEU A 39 ? ? -10.75 -59.11 134 11 LEU A 40 ? ? -153.20 39.38 135 11 LEU A 47 ? ? -67.41 78.98 136 11 ASP A 50 ? ? 39.12 88.25 137 11 ALA A 52 ? ? -179.10 70.07 138 11 GLN A 67 ? ? -29.79 -61.97 139 12 LYS A 2 ? ? -118.08 -160.22 140 12 ASP A 8 ? ? -66.79 -170.85 141 12 SER A 9 ? ? -76.80 48.93 142 12 SER A 10 ? ? -170.89 -38.18 143 12 GLU A 15 ? ? -71.31 -75.05 144 12 CYS A 16 ? ? 66.77 154.31 145 12 TYR A 36 ? ? 169.14 174.20 146 12 LEU A 39 ? ? -7.12 -62.53 147 12 ASP A 48 ? ? -1.56 -85.24 148 12 ALA A 52 ? ? 173.42 73.97 149 12 GLN A 67 ? ? -23.29 -62.01 150 13 ASN A 3 ? ? 59.45 111.51 151 13 SER A 9 ? ? -65.52 63.84 152 13 SER A 10 ? ? -177.48 -31.26 153 13 GLU A 15 ? ? -76.56 -111.80 154 13 CYS A 16 ? ? 89.49 149.10 155 13 ASN A 19 ? ? -3.97 -67.98 156 13 TYR A 31 ? ? 76.35 31.46 157 13 THR A 33 ? ? -86.09 -84.99 158 13 SER A 34 ? ? -89.99 -159.27 159 13 TYR A 36 ? ? 173.83 168.57 160 13 LEU A 39 ? ? -15.98 -41.34 161 13 LEU A 40 ? ? -149.75 13.61 162 13 ASP A 48 ? ? -121.53 -64.35 163 13 CYS A 64 ? ? -108.59 51.30 164 13 ASP A 65 ? ? -139.93 -51.59 165 13 GLN A 67 ? ? -26.03 -67.25 166 14 LYS A 2 ? ? -149.76 -147.86 167 14 SER A 9 ? ? -65.29 19.48 168 14 SER A 10 ? ? -151.21 -31.31 169 14 GLU A 15 ? ? -47.08 -78.35 170 14 CYS A 16 ? ? 59.23 176.47 171 14 LEU A 17 ? ? -125.38 -53.14 172 14 ASN A 19 ? ? -16.31 -55.42 173 14 LEU A 39 ? ? -21.46 -44.36 174 14 LEU A 40 ? ? -152.54 33.17 175 14 LEU A 47 ? ? -11.35 87.04 176 14 ASP A 48 ? ? -19.79 -84.41 177 14 ALA A 52 ? ? 38.86 64.51 178 14 ASP A 65 ? ? -136.29 -51.88 179 14 GLN A 67 ? ? -27.69 -71.08 180 15 ASP A 8 ? ? -100.60 -160.38 181 15 SER A 9 ? ? -69.72 43.08 182 15 SER A 10 ? ? -142.64 -57.58 183 15 GLU A 15 ? ? -46.97 -75.46 184 15 CYS A 16 ? ? 60.77 166.42 185 15 ASN A 19 ? ? -19.91 -47.93 186 15 TYR A 36 ? ? 173.59 165.87 187 15 LEU A 39 ? ? -7.00 -58.46 188 15 LEU A 40 ? ? -153.62 44.10 189 15 ASP A 50 ? ? 20.21 78.38 190 15 ALA A 52 ? ? -176.67 65.26 191 15 ASP A 65 ? ? -128.84 -61.96 192 15 GLN A 67 ? ? -18.30 -63.69 193 16 LYS A 2 ? ? -171.59 143.28 194 16 ASP A 8 ? ? -35.50 -75.04 195 16 SER A 9 ? ? 168.46 -48.41 196 16 GLU A 15 ? ? -77.31 -126.41 197 16 CYS A 16 ? ? 102.36 159.00 198 16 ASN A 19 ? ? -33.20 -39.28 199 16 LEU A 39 ? ? -12.02 -60.20 200 16 LEU A 40 ? ? -153.69 41.41 201 16 LEU A 47 ? ? -42.21 161.40 202 16 ALA A 52 ? ? 30.52 59.70 203 16 ASP A 65 ? ? -123.72 -59.96 204 16 GLN A 67 ? ? -18.25 -69.31 205 17 LYS A 2 ? ? -139.45 -158.58 206 17 ASP A 8 ? ? -90.84 -149.50 207 17 GLU A 15 ? ? -42.78 -71.70 208 17 CYS A 16 ? ? 64.32 145.37 209 17 ASN A 19 ? ? -10.96 -61.60 210 17 TYR A 31 ? ? 74.28 33.88 211 17 TYR A 36 ? ? 172.97 172.31 212 17 LEU A 39 ? ? -14.64 -58.32 213 17 LEU A 40 ? ? -150.78 38.54 214 17 ALA A 52 ? ? 176.56 65.25 215 17 ASP A 65 ? ? -104.01 -67.28 216 18 ASP A 8 ? ? 18.44 -79.94 217 18 SER A 9 ? ? 173.81 -41.16 218 18 GLU A 15 ? ? -79.36 -120.11 219 18 CYS A 16 ? ? 106.17 147.99 220 18 ASN A 19 ? ? -17.08 -58.21 221 18 TYR A 36 ? ? 175.48 164.91 222 18 LEU A 39 ? ? -6.41 -56.80 223 18 LEU A 40 ? ? -152.45 38.57 224 18 ASP A 50 ? ? -36.00 -34.82 225 18 ASP A 65 ? ? -132.47 -55.87 226 18 GLN A 67 ? ? -19.53 -66.42 227 19 LYS A 2 ? ? -142.95 -158.61 228 19 ASP A 8 ? ? -10.51 -75.86 229 19 SER A 9 ? ? 172.58 -47.51 230 19 CYS A 16 ? ? 163.63 173.11 231 19 ASN A 19 ? ? -16.98 -52.72 232 19 LEU A 39 ? ? -11.04 -55.90 233 19 LEU A 40 ? ? -152.76 38.55 234 19 SER A 41 ? ? -164.26 -169.49 235 19 LEU A 47 ? ? -60.64 -179.38 236 19 ASP A 49 ? ? -31.37 -73.08 237 19 ASP A 50 ? ? -165.26 116.42 238 19 ALA A 52 ? ? 167.05 56.88 239 19 ASP A 65 ? ? -128.59 -59.10 240 19 GLN A 67 ? ? -21.59 -68.54 241 20 ASP A 8 ? ? 4.40 -78.82 242 20 SER A 9 ? ? 175.81 -47.20 243 20 CYS A 16 ? ? 57.94 175.07 244 20 LEU A 39 ? ? -22.61 -51.24 245 20 LEU A 40 ? ? -152.45 44.83 246 20 LEU A 47 ? ? -68.38 73.19 247 20 ALA A 52 ? ? 167.89 70.07 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 4 GLY A 11 ? ? LYS A 12 ? ? 143.45 2 6 ALA A 6 ? ? VAL A 7 ? ? 149.50 3 6 TYR A 31 ? ? ALA A 32 ? ? 144.44 4 7 GLY A 4 ? ? TYR A 5 ? ? 146.63 5 7 TYR A 31 ? ? ALA A 32 ? ? 147.76 6 9 ASP A 8 ? ? SER A 9 ? ? 149.70 7 10 TYR A 31 ? ? ALA A 32 ? ? 139.98 8 12 VAL A 13 ? ? SER A 14 ? ? 149.99 9 13 TYR A 31 ? ? ALA A 32 ? ? 144.94 10 13 ASP A 48 ? ? ASP A 49 ? ? 147.43 11 14 GLY A 11 ? ? LYS A 12 ? ? 147.74 12 14 ASP A 48 ? ? ASP A 49 ? ? 141.81 13 15 GLY A 11 ? ? LYS A 12 ? ? 138.09 14 17 LYS A 1 ? ? LYS A 2 ? ? -146.55 15 17 LYS A 2 ? ? ASN A 3 ? ? 147.58 16 18 ASN A 3 ? ? GLY A 4 ? ? -148.91 17 18 VAL A 7 ? ? ASP A 8 ? ? 141.65 18 19 ASP A 49 ? ? ASP A 50 ? ? 145.81 19 19 LYS A 55 ? ? ILE A 56 ? ? -147.73 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 21 ? ? 0.140 'SIDE CHAIN' 2 1 TYR A 30 ? ? 0.112 'SIDE CHAIN' 3 1 TYR A 31 ? ? 0.187 'SIDE CHAIN' 4 1 TYR A 36 ? ? 0.068 'SIDE CHAIN' 5 1 TYR A 43 ? ? 0.100 'SIDE CHAIN' 6 1 PHE A 45 ? ? 0.080 'SIDE CHAIN' 7 2 TYR A 21 ? ? 0.068 'SIDE CHAIN' 8 2 TYR A 30 ? ? 0.168 'SIDE CHAIN' 9 2 TYR A 31 ? ? 0.186 'SIDE CHAIN' 10 2 TYR A 36 ? ? 0.130 'SIDE CHAIN' 11 2 TYR A 43 ? ? 0.134 'SIDE CHAIN' 12 3 TYR A 5 ? ? 0.119 'SIDE CHAIN' 13 3 TYR A 36 ? ? 0.117 'SIDE CHAIN' 14 4 TYR A 5 ? ? 0.124 'SIDE CHAIN' 15 4 TYR A 31 ? ? 0.198 'SIDE CHAIN' 16 4 TYR A 36 ? ? 0.161 'SIDE CHAIN' 17 4 TYR A 43 ? ? 0.104 'SIDE CHAIN' 18 5 TYR A 5 ? ? 0.188 'SIDE CHAIN' 19 5 TYR A 31 ? ? 0.207 'SIDE CHAIN' 20 5 TYR A 36 ? ? 0.081 'SIDE CHAIN' 21 5 TYR A 63 ? ? 0.229 'SIDE CHAIN' 22 6 TYR A 5 ? ? 0.065 'SIDE CHAIN' 23 6 TYR A 30 ? ? 0.130 'SIDE CHAIN' 24 6 TYR A 31 ? ? 0.205 'SIDE CHAIN' 25 6 TYR A 36 ? ? 0.147 'SIDE CHAIN' 26 6 TYR A 43 ? ? 0.110 'SIDE CHAIN' 27 7 TYR A 5 ? ? 0.071 'SIDE CHAIN' 28 7 TYR A 21 ? ? 0.072 'SIDE CHAIN' 29 7 TYR A 36 ? ? 0.090 'SIDE CHAIN' 30 8 TYR A 5 ? ? 0.107 'SIDE CHAIN' 31 8 TYR A 30 ? ? 0.105 'SIDE CHAIN' 32 8 TYR A 31 ? ? 0.168 'SIDE CHAIN' 33 8 TYR A 36 ? ? 0.070 'SIDE CHAIN' 34 8 TYR A 43 ? ? 0.084 'SIDE CHAIN' 35 8 PHE A 45 ? ? 0.088 'SIDE CHAIN' 36 8 TYR A 63 ? ? 0.064 'SIDE CHAIN' 37 9 TYR A 5 ? ? 0.256 'SIDE CHAIN' 38 9 TYR A 30 ? ? 0.141 'SIDE CHAIN' 39 9 TYR A 31 ? ? 0.178 'SIDE CHAIN' 40 9 TYR A 36 ? ? 0.125 'SIDE CHAIN' 41 9 TYR A 43 ? ? 0.106 'SIDE CHAIN' 42 9 TYR A 63 ? ? 0.157 'SIDE CHAIN' 43 10 TYR A 21 ? ? 0.076 'SIDE CHAIN' 44 10 TYR A 31 ? ? 0.182 'SIDE CHAIN' 45 10 TYR A 36 ? ? 0.083 'SIDE CHAIN' 46 10 TYR A 43 ? ? 0.150 'SIDE CHAIN' 47 11 TYR A 5 ? ? 0.125 'SIDE CHAIN' 48 11 TYR A 30 ? ? 0.118 'SIDE CHAIN' 49 11 TYR A 31 ? ? 0.209 'SIDE CHAIN' 50 11 TYR A 36 ? ? 0.073 'SIDE CHAIN' 51 11 TYR A 43 ? ? 0.083 'SIDE CHAIN' 52 11 TYR A 63 ? ? 0.079 'SIDE CHAIN' 53 12 TYR A 31 ? ? 0.216 'SIDE CHAIN' 54 12 TYR A 36 ? ? 0.085 'SIDE CHAIN' 55 12 TYR A 43 ? ? 0.078 'SIDE CHAIN' 56 13 TYR A 31 ? ? 0.146 'SIDE CHAIN' 57 13 TYR A 36 ? ? 0.128 'SIDE CHAIN' 58 13 TYR A 63 ? ? 0.082 'SIDE CHAIN' 59 14 TYR A 5 ? ? 0.195 'SIDE CHAIN' 60 14 TYR A 30 ? ? 0.123 'SIDE CHAIN' 61 14 TYR A 31 ? ? 0.176 'SIDE CHAIN' 62 14 TYR A 36 ? ? 0.093 'SIDE CHAIN' 63 14 TYR A 63 ? ? 0.101 'SIDE CHAIN' 64 15 TYR A 30 ? ? 0.090 'SIDE CHAIN' 65 15 TYR A 31 ? ? 0.183 'SIDE CHAIN' 66 15 TYR A 36 ? ? 0.080 'SIDE CHAIN' 67 15 PHE A 45 ? ? 0.080 'SIDE CHAIN' 68 15 TYR A 63 ? ? 0.236 'SIDE CHAIN' 69 16 TYR A 5 ? ? 0.096 'SIDE CHAIN' 70 16 TYR A 31 ? ? 0.200 'SIDE CHAIN' 71 16 TYR A 43 ? ? 0.121 'SIDE CHAIN' 72 16 PHE A 45 ? ? 0.104 'SIDE CHAIN' 73 16 TYR A 63 ? ? 0.087 'SIDE CHAIN' 74 17 TYR A 5 ? ? 0.121 'SIDE CHAIN' 75 17 TYR A 30 ? ? 0.110 'SIDE CHAIN' 76 17 TYR A 31 ? ? 0.188 'SIDE CHAIN' 77 17 TYR A 36 ? ? 0.090 'SIDE CHAIN' 78 17 TYR A 63 ? ? 0.065 'SIDE CHAIN' 79 18 TYR A 30 ? ? 0.107 'SIDE CHAIN' 80 18 TYR A 31 ? ? 0.153 'SIDE CHAIN' 81 18 TYR A 36 ? ? 0.099 'SIDE CHAIN' 82 19 TYR A 5 ? ? 0.135 'SIDE CHAIN' 83 19 TYR A 31 ? ? 0.139 'SIDE CHAIN' 84 19 TYR A 36 ? ? 0.083 'SIDE CHAIN' 85 20 TYR A 30 ? ? 0.112 'SIDE CHAIN' 86 20 TYR A 31 ? ? 0.067 'SIDE CHAIN' 87 20 TYR A 36 ? ? 0.175 'SIDE CHAIN' 88 20 TYR A 63 ? ? 0.197 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1WWN _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WWN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 2.0mM '90% H2O/10% D2O' 2 2.0mM '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.80 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY, 2D TOCSY, DQF-COSY' 2 2 1 '2D NOESY, 2D TOCSY, DQF-COSY' # _pdbx_nmr_details.entry_id 1WWN _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_refine.entry_id 1WWN _pdbx_nmr_refine.method ;The structure are based on a total of 884 constraints, 814 are NOE-derived distance constraints,26 dihedral angle constraints,44 distance constraints from sixteen hydrogen bonds and four disulfide bonds. ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1B collection 'Mike Carlisle, Dan Steele, and Mike Miller' 1 VNMR 6.1B processing 'Mike Carlisle, Dan Steele, and Mike Miller' 2 XEASY 1994 'data analysis' 'Tai-he Xia and Christian Bartel' 3 DYANA 1.5 'structure solution' 'Peter Guntert, Christian Mumenthaler and Torsten Herrmann' 4 Amber 5.0 refinement ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 ILE N N N N 110 ILE CA C N S 111 ILE C C N N 112 ILE O O N N 113 ILE CB C N S 114 ILE CG1 C N N 115 ILE CG2 C N N 116 ILE CD1 C N N 117 ILE OXT O N N 118 ILE H H N N 119 ILE H2 H N N 120 ILE HA H N N 121 ILE HB H N N 122 ILE HG12 H N N 123 ILE HG13 H N N 124 ILE HG21 H N N 125 ILE HG22 H N N 126 ILE HG23 H N N 127 ILE HD11 H N N 128 ILE HD12 H N N 129 ILE HD13 H N N 130 ILE HXT H N N 131 LEU N N N N 132 LEU CA C N S 133 LEU C C N N 134 LEU O O N N 135 LEU CB C N N 136 LEU CG C N N 137 LEU CD1 C N N 138 LEU CD2 C N N 139 LEU OXT O N N 140 LEU H H N N 141 LEU H2 H N N 142 LEU HA H N N 143 LEU HB2 H N N 144 LEU HB3 H N N 145 LEU HG H N N 146 LEU HD11 H N N 147 LEU HD12 H N N 148 LEU HD13 H N N 149 LEU HD21 H N N 150 LEU HD22 H N N 151 LEU HD23 H N N 152 LEU HXT H N N 153 LYS N N N N 154 LYS CA C N S 155 LYS C C N N 156 LYS O O N N 157 LYS CB C N N 158 LYS CG C N N 159 LYS CD C N N 160 LYS CE C N N 161 LYS NZ N N N 162 LYS OXT O N N 163 LYS H H N N 164 LYS H2 H N N 165 LYS HA H N N 166 LYS HB2 H N N 167 LYS HB3 H N N 168 LYS HG2 H N N 169 LYS HG3 H N N 170 LYS HD2 H N N 171 LYS HD3 H N N 172 LYS HE2 H N N 173 LYS HE3 H N N 174 LYS HZ1 H N N 175 LYS HZ2 H N N 176 LYS HZ3 H N N 177 LYS HXT H N N 178 PHE N N N N 179 PHE CA C N S 180 PHE C C N N 181 PHE O O N N 182 PHE CB C N N 183 PHE CG C Y N 184 PHE CD1 C Y N 185 PHE CD2 C Y N 186 PHE CE1 C Y N 187 PHE CE2 C Y N 188 PHE CZ C Y N 189 PHE OXT O N N 190 PHE H H N N 191 PHE H2 H N N 192 PHE HA H N N 193 PHE HB2 H N N 194 PHE HB3 H N N 195 PHE HD1 H N N 196 PHE HD2 H N N 197 PHE HE1 H N N 198 PHE HE2 H N N 199 PHE HZ H N N 200 PHE HXT H N N 201 SER N N N N 202 SER CA C N S 203 SER C C N N 204 SER O O N N 205 SER CB C N N 206 SER OG O N N 207 SER OXT O N N 208 SER H H N N 209 SER H2 H N N 210 SER HA H N N 211 SER HB2 H N N 212 SER HB3 H N N 213 SER HG H N N 214 SER HXT H N N 215 THR N N N N 216 THR CA C N S 217 THR C C N N 218 THR O O N N 219 THR CB C N R 220 THR OG1 O N N 221 THR CG2 C N N 222 THR OXT O N N 223 THR H H N N 224 THR H2 H N N 225 THR HA H N N 226 THR HB H N N 227 THR HG1 H N N 228 THR HG21 H N N 229 THR HG22 H N N 230 THR HG23 H N N 231 THR HXT H N N 232 TYR N N N N 233 TYR CA C N S 234 TYR C C N N 235 TYR O O N N 236 TYR CB C N N 237 TYR CG C Y N 238 TYR CD1 C Y N 239 TYR CD2 C Y N 240 TYR CE1 C Y N 241 TYR CE2 C Y N 242 TYR CZ C Y N 243 TYR OH O N N 244 TYR OXT O N N 245 TYR H H N N 246 TYR H2 H N N 247 TYR HA H N N 248 TYR HB2 H N N 249 TYR HB3 H N N 250 TYR HD1 H N N 251 TYR HD2 H N N 252 TYR HE1 H N N 253 TYR HE2 H N N 254 TYR HH H N N 255 TYR HXT H N N 256 VAL N N N N 257 VAL CA C N S 258 VAL C C N N 259 VAL O O N N 260 VAL CB C N N 261 VAL CG1 C N N 262 VAL CG2 C N N 263 VAL OXT O N N 264 VAL H H N N 265 VAL H2 H N N 266 VAL HA H N N 267 VAL HB H N N 268 VAL HG11 H N N 269 VAL HG12 H N N 270 VAL HG13 H N N 271 VAL HG21 H N N 272 VAL HG22 H N N 273 VAL HG23 H N N 274 VAL HXT H N N 275 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 ILE N CA sing N N 103 ILE N H sing N N 104 ILE N H2 sing N N 105 ILE CA C sing N N 106 ILE CA CB sing N N 107 ILE CA HA sing N N 108 ILE C O doub N N 109 ILE C OXT sing N N 110 ILE CB CG1 sing N N 111 ILE CB CG2 sing N N 112 ILE CB HB sing N N 113 ILE CG1 CD1 sing N N 114 ILE CG1 HG12 sing N N 115 ILE CG1 HG13 sing N N 116 ILE CG2 HG21 sing N N 117 ILE CG2 HG22 sing N N 118 ILE CG2 HG23 sing N N 119 ILE CD1 HD11 sing N N 120 ILE CD1 HD12 sing N N 121 ILE CD1 HD13 sing N N 122 ILE OXT HXT sing N N 123 LEU N CA sing N N 124 LEU N H sing N N 125 LEU N H2 sing N N 126 LEU CA C sing N N 127 LEU CA CB sing N N 128 LEU CA HA sing N N 129 LEU C O doub N N 130 LEU C OXT sing N N 131 LEU CB CG sing N N 132 LEU CB HB2 sing N N 133 LEU CB HB3 sing N N 134 LEU CG CD1 sing N N 135 LEU CG CD2 sing N N 136 LEU CG HG sing N N 137 LEU CD1 HD11 sing N N 138 LEU CD1 HD12 sing N N 139 LEU CD1 HD13 sing N N 140 LEU CD2 HD21 sing N N 141 LEU CD2 HD22 sing N N 142 LEU CD2 HD23 sing N N 143 LEU OXT HXT sing N N 144 LYS N CA sing N N 145 LYS N H sing N N 146 LYS N H2 sing N N 147 LYS CA C sing N N 148 LYS CA CB sing N N 149 LYS CA HA sing N N 150 LYS C O doub N N 151 LYS C OXT sing N N 152 LYS CB CG sing N N 153 LYS CB HB2 sing N N 154 LYS CB HB3 sing N N 155 LYS CG CD sing N N 156 LYS CG HG2 sing N N 157 LYS CG HG3 sing N N 158 LYS CD CE sing N N 159 LYS CD HD2 sing N N 160 LYS CD HD3 sing N N 161 LYS CE NZ sing N N 162 LYS CE HE2 sing N N 163 LYS CE HE3 sing N N 164 LYS NZ HZ1 sing N N 165 LYS NZ HZ2 sing N N 166 LYS NZ HZ3 sing N N 167 LYS OXT HXT sing N N 168 PHE N CA sing N N 169 PHE N H sing N N 170 PHE N H2 sing N N 171 PHE CA C sing N N 172 PHE CA CB sing N N 173 PHE CA HA sing N N 174 PHE C O doub N N 175 PHE C OXT sing N N 176 PHE CB CG sing N N 177 PHE CB HB2 sing N N 178 PHE CB HB3 sing N N 179 PHE CG CD1 doub Y N 180 PHE CG CD2 sing Y N 181 PHE CD1 CE1 sing Y N 182 PHE CD1 HD1 sing N N 183 PHE CD2 CE2 doub Y N 184 PHE CD2 HD2 sing N N 185 PHE CE1 CZ doub Y N 186 PHE CE1 HE1 sing N N 187 PHE CE2 CZ sing Y N 188 PHE CE2 HE2 sing N N 189 PHE CZ HZ sing N N 190 PHE OXT HXT sing N N 191 SER N CA sing N N 192 SER N H sing N N 193 SER N H2 sing N N 194 SER CA C sing N N 195 SER CA CB sing N N 196 SER CA HA sing N N 197 SER C O doub N N 198 SER C OXT sing N N 199 SER CB OG sing N N 200 SER CB HB2 sing N N 201 SER CB HB3 sing N N 202 SER OG HG sing N N 203 SER OXT HXT sing N N 204 THR N CA sing N N 205 THR N H sing N N 206 THR N H2 sing N N 207 THR CA C sing N N 208 THR CA CB sing N N 209 THR CA HA sing N N 210 THR C O doub N N 211 THR C OXT sing N N 212 THR CB OG1 sing N N 213 THR CB CG2 sing N N 214 THR CB HB sing N N 215 THR OG1 HG1 sing N N 216 THR CG2 HG21 sing N N 217 THR CG2 HG22 sing N N 218 THR CG2 HG23 sing N N 219 THR OXT HXT sing N N 220 TYR N CA sing N N 221 TYR N H sing N N 222 TYR N H2 sing N N 223 TYR CA C sing N N 224 TYR CA CB sing N N 225 TYR CA HA sing N N 226 TYR C O doub N N 227 TYR C OXT sing N N 228 TYR CB CG sing N N 229 TYR CB HB2 sing N N 230 TYR CB HB3 sing N N 231 TYR CG CD1 doub Y N 232 TYR CG CD2 sing Y N 233 TYR CD1 CE1 sing Y N 234 TYR CD1 HD1 sing N N 235 TYR CD2 CE2 doub Y N 236 TYR CD2 HD2 sing N N 237 TYR CE1 CZ doub Y N 238 TYR CE1 HE1 sing N N 239 TYR CE2 CZ sing Y N 240 TYR CE2 HE2 sing N N 241 TYR CZ OH sing N N 242 TYR OH HH sing N N 243 TYR OXT HXT sing N N 244 VAL N CA sing N N 245 VAL N H sing N N 246 VAL N H2 sing N N 247 VAL CA C sing N N 248 VAL CA CB sing N N 249 VAL CA HA sing N N 250 VAL C O doub N N 251 VAL C OXT sing N N 252 VAL CB CG1 sing N N 253 VAL CB CG2 sing N N 254 VAL CB HB sing N N 255 VAL CG1 HG11 sing N N 256 VAL CG1 HG12 sing N N 257 VAL CG1 HG13 sing N N 258 VAL CG2 HG21 sing N N 259 VAL CG2 HG22 sing N N 260 VAL CG2 HG23 sing N N 261 VAL OXT HXT sing N N 262 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1WWN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_