data_1WY8 # _entry.id 1WY8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WY8 pdb_00001wy8 10.2210/pdb1wy8/pdb RCSB RCSB024144 ? ? WWPDB D_1000024144 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002011909.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WY8 _pdbx_database_status.recvd_initial_deposition_date 2005-02-09 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhao, C.' 1 'Saito, K.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title ;Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF) ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhao, C.' 1 ? primary 'Saito, K.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Np95-like ring finger protein, isoform a' _entity.formula_weight 10040.245 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'ubiquitin-like domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Np95/ICBP90-like ring finger protein, NIRF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLV RPDSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLV RPDSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002011909.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 TRP n 1 10 ILE n 1 11 GLN n 1 12 VAL n 1 13 ARG n 1 14 THR n 1 15 ILE n 1 16 ASP n 1 17 GLY n 1 18 SER n 1 19 LYS n 1 20 THR n 1 21 CYS n 1 22 THR n 1 23 ILE n 1 24 GLU n 1 25 ASP n 1 26 VAL n 1 27 SER n 1 28 ARG n 1 29 LYS n 1 30 ALA n 1 31 THR n 1 32 ILE n 1 33 GLU n 1 34 GLU n 1 35 LEU n 1 36 ARG n 1 37 GLU n 1 38 ARG n 1 39 VAL n 1 40 TRP n 1 41 ALA n 1 42 LEU n 1 43 PHE n 1 44 ASP n 1 45 VAL n 1 46 ARG n 1 47 PRO n 1 48 GLU n 1 49 CYS n 1 50 GLN n 1 51 ARG n 1 52 LEU n 1 53 PHE n 1 54 TYR n 1 55 ARG n 1 56 GLY n 1 57 LYS n 1 58 GLN n 1 59 LEU n 1 60 GLU n 1 61 ASN n 1 62 GLY n 1 63 TYR n 1 64 THR n 1 65 LEU n 1 66 PHE n 1 67 ASP n 1 68 TYR n 1 69 ASP n 1 70 VAL n 1 71 GLY n 1 72 LEU n 1 73 ASN n 1 74 ASP n 1 75 ILE n 1 76 ILE n 1 77 GLN n 1 78 LEU n 1 79 LEU n 1 80 VAL n 1 81 ARG n 1 82 PRO n 1 83 ASP n 1 84 SER n 1 85 GLY n 1 86 PRO n 1 87 SER n 1 88 SER n 1 89 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene UHRF2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041101-10 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UHRF2_HUMAN _struct_ref.pdbx_db_accession Q96PU4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLVRPD _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WY8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96PU4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WY8 GLY A 1 ? UNP Q96PU4 ? ? 'cloning artifact' 1 1 1 1WY8 SER A 2 ? UNP Q96PU4 ? ? 'cloning artifact' 2 2 1 1WY8 SER A 3 ? UNP Q96PU4 ? ? 'cloning artifact' 3 3 1 1WY8 GLY A 4 ? UNP Q96PU4 ? ? 'cloning artifact' 4 4 1 1WY8 SER A 5 ? UNP Q96PU4 ? ? 'cloning artifact' 5 5 1 1WY8 SER A 6 ? UNP Q96PU4 ? ? 'cloning artifact' 6 6 1 1WY8 GLY A 7 ? UNP Q96PU4 ? ? 'cloning artifact' 7 7 1 1WY8 SER A 84 ? UNP Q96PU4 ? ? 'cloning artifact' 84 8 1 1WY8 GLY A 85 ? UNP Q96PU4 ? ? 'cloning artifact' 85 9 1 1WY8 PRO A 86 ? UNP Q96PU4 ? ? 'cloning artifact' 86 10 1 1WY8 SER A 87 ? UNP Q96PU4 ? ? 'cloning artifact' 87 11 1 1WY8 SER A 88 ? UNP Q96PU4 ? ? 'cloning artifact' 88 12 1 1WY8 GLY A 89 ? UNP Q96PU4 ? ? 'cloning artifact' 89 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.91mM protein U-15N, 13C/20mM d-Tris-HCl, 100mM NaCl, 1mM d-DTT, 0.02% NaN3, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1WY8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WY8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WY8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20020425 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B. A.' 3 'data analysis' KUJIRA 0.921 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guentert, P.' 5 refinement CYANA 2.0.17 'Guentert, P.' 6 # _exptl.entry_id 1WY8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1WY8 _struct.title 'Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like Ring Finger Protein (NIRF)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WY8 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;Ubiquitin-like domain, Np95/ICBP90-like ring finger (NIRF), ubiquitin ligase, Structural genomics, NPPSFA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 32 ? LEU A 42 ? ILE A 32 LEU A 42 1 ? 11 HELX_P HELX_P2 2 LEU A 65 ? TYR A 68 ? LEU A 65 TYR A 68 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 20 ? VAL A 26 ? THR A 20 VAL A 26 A 2 MET A 8 ? THR A 14 ? MET A 8 THR A 14 A 3 ILE A 75 ? VAL A 80 ? ILE A 75 VAL A 80 A 4 GLN A 50 ? TYR A 54 ? GLN A 50 TYR A 54 A 5 LYS A 57 ? GLN A 58 ? LYS A 57 GLN A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 26 ? O VAL A 26 N MET A 8 ? N MET A 8 A 2 3 N ARG A 13 ? N ARG A 13 O LEU A 78 ? O LEU A 78 A 3 4 O GLN A 77 ? O GLN A 77 N PHE A 53 ? N PHE A 53 A 4 5 N TYR A 54 ? N TYR A 54 O LYS A 57 ? O LYS A 57 # _database_PDB_matrix.entry_id 1WY8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WY8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-08-09 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: Author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 46 ? ? -42.76 154.63 2 1 GLN A 58 ? ? -48.44 96.32 3 1 PRO A 82 ? ? -69.78 -179.45 4 1 PRO A 86 ? ? -69.74 1.14 5 1 SER A 87 ? ? -36.91 115.15 6 2 ILE A 15 ? ? -35.19 -32.56 7 2 ARG A 46 ? ? -40.32 154.70 8 2 GLN A 58 ? ? -50.58 96.42 9 2 ASN A 73 ? ? 71.03 43.43 10 2 SER A 84 ? ? -171.19 138.32 11 2 SER A 88 ? ? -37.08 118.93 12 3 ARG A 46 ? ? -39.93 156.05 13 3 GLN A 58 ? ? -50.16 95.99 14 3 SER A 84 ? ? -93.97 41.97 15 4 SER A 5 ? ? -122.45 -55.41 16 4 ILE A 15 ? ? -35.96 -34.14 17 4 ARG A 46 ? ? -45.13 154.06 18 4 GLN A 58 ? ? -44.71 96.90 19 5 ILE A 15 ? ? -34.25 -34.89 20 5 GLN A 58 ? ? -52.08 96.53 21 5 PRO A 82 ? ? -69.74 92.72 22 5 PRO A 86 ? ? -69.72 -179.47 23 6 ILE A 15 ? ? -39.77 -39.50 24 6 ASP A 25 ? ? 74.79 44.39 25 6 ARG A 46 ? ? -42.42 154.66 26 6 GLN A 58 ? ? -48.43 96.25 27 6 PRO A 82 ? ? -69.81 97.59 28 6 SER A 84 ? ? -172.54 124.66 29 7 ILE A 15 ? ? -34.74 -37.72 30 7 ASP A 25 ? ? 74.12 44.43 31 7 ARG A 46 ? ? -47.73 153.82 32 7 ARG A 55 ? ? 39.87 48.36 33 7 GLN A 58 ? ? -51.15 96.28 34 8 ARG A 46 ? ? -44.35 151.92 35 8 ARG A 55 ? ? 38.81 50.64 36 8 GLN A 58 ? ? -50.79 96.99 37 9 SER A 5 ? ? -85.81 48.54 38 9 SER A 18 ? ? -133.85 -43.75 39 9 ASP A 25 ? ? 70.87 46.51 40 9 ARG A 46 ? ? -46.40 154.93 41 9 GLN A 58 ? ? -49.24 96.53 42 9 ASN A 73 ? ? 71.22 45.25 43 9 SER A 87 ? ? -43.79 166.16 44 10 SER A 2 ? ? -174.52 134.65 45 10 SER A 5 ? ? -133.46 -47.09 46 10 ILE A 15 ? ? -34.26 -33.66 47 10 ASP A 25 ? ? 74.91 45.99 48 10 ARG A 46 ? ? -43.97 156.11 49 10 GLN A 58 ? ? -50.77 96.70 50 10 ASP A 83 ? ? -43.46 156.25 51 11 SER A 2 ? ? -66.70 84.97 52 11 SER A 3 ? ? -61.12 96.80 53 11 SER A 6 ? ? -55.79 100.37 54 11 ARG A 46 ? ? -42.66 152.20 55 11 GLN A 58 ? ? -48.41 96.85 56 11 SER A 84 ? ? -100.01 41.76 57 11 SER A 87 ? ? 39.42 43.44 58 12 SER A 2 ? ? -163.77 112.49 59 12 ASP A 25 ? ? 73.30 46.44 60 12 ARG A 46 ? ? -45.11 153.83 61 12 GLN A 58 ? ? -47.12 98.96 62 12 PRO A 82 ? ? -69.76 -165.49 63 12 PRO A 86 ? ? -69.83 0.07 64 13 ARG A 46 ? ? -37.57 154.68 65 13 GLN A 58 ? ? -50.65 96.68 66 13 PRO A 86 ? ? -69.76 2.21 67 14 ILE A 15 ? ? -38.91 -32.53 68 14 ARG A 46 ? ? -42.08 155.12 69 14 GLN A 58 ? ? -51.51 97.02 70 14 SER A 88 ? ? -48.46 160.49 71 15 ILE A 15 ? ? -36.75 -33.88 72 15 ASP A 25 ? ? 73.97 45.91 73 15 ARG A 46 ? ? -38.69 154.70 74 15 GLN A 58 ? ? -50.11 96.85 75 15 ASN A 73 ? ? 70.07 40.68 76 15 SER A 87 ? ? -34.62 141.80 77 16 SER A 3 ? ? -38.61 -36.77 78 16 ARG A 46 ? ? -43.72 154.24 79 16 GLN A 58 ? ? -50.92 97.38 80 16 SER A 87 ? ? -67.09 97.43 81 17 ILE A 15 ? ? -33.92 -37.23 82 17 ARG A 46 ? ? -43.93 156.54 83 17 GLN A 58 ? ? -50.13 96.19 84 18 ILE A 15 ? ? -38.63 -32.42 85 18 GLN A 58 ? ? -49.66 97.46 86 19 ASP A 25 ? ? 71.39 43.62 87 19 ARG A 46 ? ? -43.79 155.83 88 19 GLN A 58 ? ? -51.91 96.15 89 19 PRO A 86 ? ? -69.79 2.78 90 19 SER A 87 ? ? 72.69 40.61 91 20 ARG A 46 ? ? -40.04 154.34 92 20 GLN A 58 ? ? -49.32 96.25 93 20 PRO A 82 ? ? -69.73 95.12 #