data_1WYR # _entry.id 1WYR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WYR pdb_00001wyr 10.2210/pdb1wyr/pdb RCSB RCSB024162 ? ? WWPDB D_1000024162 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk001000001.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WYR _pdbx_database_status.recvd_initial_deposition_date 2005-02-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Kigawa, T.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the CH domain of human Rho guanine nucleotide exchange factor 6' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Rho guanine nucleotide exchange factor 6' _entity.formula_weight 12952.689 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'CH domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PAK-interacting exchange factor alpha, Alpha-Pix, COOL-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDPQTEADCINNINDFLKG CATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATESGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDPQTEADCINNINDFLKG CATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATESGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk001000001.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 GLU n 1 10 GLN n 1 11 ILE n 1 12 VAL n 1 13 THR n 1 14 TRP n 1 15 LEU n 1 16 ILE n 1 17 SER n 1 18 LEU n 1 19 GLY n 1 20 VAL n 1 21 LEU n 1 22 GLU n 1 23 SER n 1 24 PRO n 1 25 LYS n 1 26 LYS n 1 27 THR n 1 28 ILE n 1 29 CYS n 1 30 ASP n 1 31 PRO n 1 32 GLU n 1 33 GLU n 1 34 PHE n 1 35 LEU n 1 36 LYS n 1 37 SER n 1 38 SER n 1 39 LEU n 1 40 LYS n 1 41 ASN n 1 42 GLY n 1 43 VAL n 1 44 VAL n 1 45 LEU n 1 46 CYS n 1 47 LYS n 1 48 LEU n 1 49 ILE n 1 50 ASN n 1 51 ARG n 1 52 LEU n 1 53 MET n 1 54 PRO n 1 55 GLY n 1 56 SER n 1 57 VAL n 1 58 GLU n 1 59 LYS n 1 60 PHE n 1 61 CYS n 1 62 LEU n 1 63 ASP n 1 64 PRO n 1 65 GLN n 1 66 THR n 1 67 GLU n 1 68 ALA n 1 69 ASP n 1 70 CYS n 1 71 ILE n 1 72 ASN n 1 73 ASN n 1 74 ILE n 1 75 ASN n 1 76 ASP n 1 77 PHE n 1 78 LEU n 1 79 LYS n 1 80 GLY n 1 81 CYS n 1 82 ALA n 1 83 THR n 1 84 LEU n 1 85 GLN n 1 86 VAL n 1 87 GLU n 1 88 ILE n 1 89 PHE n 1 90 ASP n 1 91 PRO n 1 92 ASP n 1 93 ASP n 1 94 LEU n 1 95 TYR n 1 96 SER n 1 97 GLY n 1 98 VAL n 1 99 ASN n 1 100 PHE n 1 101 SER n 1 102 LYS n 1 103 VAL n 1 104 LEU n 1 105 SER n 1 106 THR n 1 107 LEU n 1 108 LEU n 1 109 ALA n 1 110 VAL n 1 111 ASN n 1 112 LYS n 1 113 ALA n 1 114 THR n 1 115 GLU n 1 116 SER n 1 117 GLY n 1 118 PRO n 1 119 SER n 1 120 SER n 1 121 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ARHGEF6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040910-16 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ARHG6_HUMAN _struct_ref.pdbx_db_accession Q15052 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDPQTEADCINNINDFLKGCATLQVE IFDPDDLYSGVNFSKVLSTLLAVNKATE ; _struct_ref.pdbx_align_begin 4 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WYR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 115 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15052 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 115 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WYR GLY A 1 ? UNP Q15052 ? ? 'cloning artifact' 1 1 1 1WYR SER A 2 ? UNP Q15052 ? ? 'cloning artifact' 2 2 1 1WYR SER A 3 ? UNP Q15052 ? ? 'cloning artifact' 3 3 1 1WYR GLY A 4 ? UNP Q15052 ? ? 'cloning artifact' 4 4 1 1WYR SER A 5 ? UNP Q15052 ? ? 'cloning artifact' 5 5 1 1WYR SER A 6 ? UNP Q15052 ? ? 'cloning artifact' 6 6 1 1WYR GLY A 7 ? UNP Q15052 ? ? 'cloning artifact' 7 7 1 1WYR SER A 116 ? UNP Q15052 ? ? 'cloning artifact' 116 8 1 1WYR GLY A 117 ? UNP Q15052 ? ? 'cloning artifact' 117 9 1 1WYR PRO A 118 ? UNP Q15052 ? ? 'cloning artifact' 118 10 1 1WYR SER A 119 ? UNP Q15052 ? ? 'cloning artifact' 119 11 1 1WYR SER A 120 ? UNP Q15052 ? ? 'cloning artifact' 120 12 1 1WYR GLY A 121 ? UNP Q15052 ? ? 'cloning artifact' 121 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.32mM CH domain U-15N,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1WYR _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WYR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WYR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guentert, P.' 5 refinement CYANA 2.0.17 'Guentert, P.' 6 # _exptl.entry_id 1WYR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1WYR _struct.title 'Solution structure of the CH domain of human Rho guanine nucleotide exchange factor 6' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WYR _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'CH domain, all-alpha, NPPSFA, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 7 ? GLY A 19 ? GLY A 7 GLY A 19 1 ? 13 HELX_P HELX_P2 2 ASP A 30 ? GLY A 42 ? ASP A 30 GLY A 42 1 ? 13 HELX_P HELX_P3 3 GLY A 42 ? MET A 53 ? GLY A 42 MET A 53 1 ? 12 HELX_P HELX_P4 4 THR A 66 ? GLN A 85 ? THR A 66 GLN A 85 1 ? 20 HELX_P HELX_P5 5 ASP A 90 ? SER A 96 ? ASP A 90 SER A 96 1 ? 7 HELX_P HELX_P6 6 ASN A 99 ? GLU A 115 ? ASN A 99 GLU A 115 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1WYR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WYR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 GLY 121 121 121 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-08-15 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 36.38 49.69 2 1 SER A 5 ? ? -65.27 92.53 3 1 LYS A 40 ? ? -35.29 -71.36 4 1 LEU A 48 ? ? -54.39 -70.50 5 1 LYS A 59 ? ? -174.08 124.71 6 1 THR A 106 ? ? -37.85 -39.67 7 1 GLU A 115 ? ? -35.24 125.40 8 1 SER A 120 ? ? -36.73 133.92 9 2 LYS A 26 ? ? -50.29 171.30 10 2 ILE A 28 ? ? -44.61 90.56 11 2 LEU A 48 ? ? -67.05 -70.81 12 2 LYS A 79 ? ? -38.05 -30.55 13 3 LYS A 25 ? ? -83.90 47.23 14 3 PRO A 64 ? ? -69.77 98.43 15 3 SER A 101 ? ? -37.88 -39.20 16 3 VAL A 103 ? ? -39.14 -38.87 17 4 LYS A 26 ? ? -48.52 169.06 18 4 PRO A 54 ? ? -69.77 98.24 19 4 ALA A 68 ? ? -38.70 -38.80 20 4 LYS A 79 ? ? -35.16 -35.08 21 5 LYS A 26 ? ? -44.05 168.80 22 5 LYS A 59 ? ? -167.38 112.95 23 5 ALA A 68 ? ? -36.13 -39.09 24 6 SER A 6 ? ? -105.16 42.24 25 6 LYS A 26 ? ? -48.41 177.85 26 6 ALA A 68 ? ? -38.43 -35.77 27 6 LYS A 79 ? ? -37.73 -37.39 28 6 SER A 101 ? ? -35.26 -38.73 29 6 THR A 114 ? ? -87.49 33.67 30 6 SER A 116 ? ? -39.75 117.73 31 6 SER A 119 ? ? -67.75 92.82 32 7 SER A 5 ? ? -44.73 164.10 33 7 LEU A 48 ? ? -73.01 -71.73 34 7 ILE A 49 ? ? -36.98 -35.09 35 7 GLU A 87 ? ? -47.32 156.16 36 7 SER A 101 ? ? -37.82 -38.78 37 8 LEU A 48 ? ? -71.26 -72.49 38 8 LYS A 59 ? ? -174.97 129.03 39 8 SER A 101 ? ? -38.66 -33.08 40 9 SER A 5 ? ? -170.00 119.13 41 9 LYS A 26 ? ? -51.91 174.64 42 9 ILE A 28 ? ? -43.94 91.81 43 9 LYS A 40 ? ? -34.28 -70.65 44 9 LEU A 48 ? ? -65.62 -71.52 45 9 ALA A 68 ? ? -39.57 -39.98 46 9 GLU A 115 ? ? -39.43 144.87 47 10 PRO A 64 ? ? -69.85 98.97 48 10 SER A 101 ? ? -35.47 -38.99 49 10 SER A 116 ? ? -93.33 47.92 50 11 LYS A 26 ? ? -48.91 179.14 51 11 LYS A 59 ? ? -164.30 118.41 52 11 SER A 101 ? ? -35.28 -39.77 53 11 SER A 119 ? ? -34.60 144.76 54 12 SER A 2 ? ? -45.78 150.05 55 12 LYS A 40 ? ? -35.86 -74.91 56 12 SER A 101 ? ? -39.07 -35.67 57 13 SER A 3 ? ? -128.76 -61.11 58 13 PRO A 24 ? ? -69.73 80.43 59 13 LYS A 25 ? ? -82.11 39.86 60 13 LYS A 26 ? ? -111.57 -73.58 61 13 CYS A 29 ? ? -34.32 -33.17 62 13 LEU A 48 ? ? -69.91 -72.97 63 13 ILE A 49 ? ? -37.16 -39.59 64 13 SER A 56 ? ? -93.46 -61.51 65 13 GLU A 87 ? ? -37.93 149.82 66 13 GLU A 115 ? ? -54.36 98.98 67 13 PRO A 118 ? ? -69.72 95.46 68 13 SER A 119 ? ? -49.42 170.61 69 14 SER A 5 ? ? -39.77 149.53 70 14 LYS A 59 ? ? -163.81 117.54 71 14 PRO A 64 ? ? -69.72 99.14 72 14 LYS A 79 ? ? -36.23 -35.40 73 14 SER A 120 ? ? -99.15 43.62 74 15 SER A 5 ? ? -57.66 175.11 75 15 LYS A 25 ? ? -45.96 -70.86 76 15 LYS A 26 ? ? -42.22 165.55 77 15 LYS A 40 ? ? -35.42 -71.35 78 15 LEU A 48 ? ? -54.43 -74.24 79 15 LYS A 59 ? ? -172.04 126.57 80 15 LYS A 79 ? ? -36.61 -37.78 81 16 SER A 2 ? ? 37.96 42.13 82 16 LYS A 25 ? ? -83.72 46.28 83 16 PRO A 54 ? ? -69.79 98.36 84 16 ALA A 68 ? ? -39.04 -37.05 85 16 GLU A 87 ? ? -46.31 155.54 86 16 SER A 101 ? ? -35.05 -35.78 87 16 THR A 114 ? ? -86.35 34.51 88 16 PRO A 118 ? ? -69.74 -179.62 89 17 LYS A 25 ? ? -82.57 49.82 90 17 PRO A 64 ? ? -69.74 99.58 91 17 ALA A 68 ? ? -38.26 -39.33 92 17 LYS A 79 ? ? -36.43 -35.15 93 17 SER A 116 ? ? -36.09 116.93 94 18 LYS A 26 ? ? -46.69 172.16 95 18 LEU A 48 ? ? -63.41 -74.27 96 18 LYS A 59 ? ? -173.91 126.45 97 18 PRO A 64 ? ? -69.79 99.86 98 19 SER A 3 ? ? -49.51 157.70 99 19 LYS A 26 ? ? -34.38 122.81 100 19 ILE A 28 ? ? -82.54 37.38 101 19 LEU A 48 ? ? -74.99 -71.87 102 19 PRO A 54 ? ? -69.75 94.47 103 19 LYS A 79 ? ? -36.49 -38.31 104 19 GLU A 115 ? ? -53.34 177.17 105 19 PRO A 118 ? ? -69.72 -178.66 106 20 SER A 5 ? ? -132.59 -53.79 107 20 LYS A 25 ? ? -82.51 47.76 108 20 LYS A 59 ? ? -166.64 119.68 109 20 ALA A 68 ? ? -39.27 -36.08 110 20 LYS A 79 ? ? -37.06 -36.23 111 20 GLU A 115 ? ? -37.98 114.39 #