data_1X37 # _entry.id 1X37 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X37 pdb_00001x37 10.2210/pdb1x37/pdb RCSB RCSB024321 ? ? WWPDB D_1000024321 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X37 _pdbx_database_status.recvd_initial_deposition_date 2005-04-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, I.' 1 'Lou, Y.C.' 2 'Lo, S.C.' 3 'Lee, Y.L.' 4 'Wu, S.H.' 5 'Chen, C.' 6 # _citation.id primary _citation.title 'Structural basis and DNA binding property of SSD domain of Bacillus subtilis Lon protease' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, I.' 1 ? primary 'Lou, Y.C.' 2 ? primary 'Lo, S.C.' 3 ? primary 'Lee, Y.L.' 4 ? primary 'Wu, S.H.' 5 ? primary 'Chen, C.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ATP-dependent protease La 1' _entity.formula_weight 14395.650 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.4.21.53 _entity.pdbx_mutation ? _entity.pdbx_fragment 'SSD domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Lon protease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAAKAIVAEERKRITV TEKNLQDFIGKRIFRYGQAETEDQVGVVTGLAYTTVLRHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAAKAIVAEERKRITV TEKNLQDFIGKRIFRYGQAETEDQVGVVTGLAYTTVLRHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLY n 1 4 TYR n 1 5 THR n 1 6 GLU n 1 7 ILE n 1 8 GLU n 1 9 LYS n 1 10 LEU n 1 11 GLU n 1 12 ILE n 1 13 VAL n 1 14 LYS n 1 15 ASP n 1 16 HIS n 1 17 LEU n 1 18 LEU n 1 19 PRO n 1 20 LYS n 1 21 GLN n 1 22 ILE n 1 23 LYS n 1 24 GLU n 1 25 HIS n 1 26 GLY n 1 27 LEU n 1 28 LYS n 1 29 LYS n 1 30 SER n 1 31 ASN n 1 32 LEU n 1 33 GLN n 1 34 LEU n 1 35 ARG n 1 36 ASP n 1 37 GLN n 1 38 ALA n 1 39 ILE n 1 40 LEU n 1 41 ASP n 1 42 ILE n 1 43 ILE n 1 44 ARG n 1 45 TYR n 1 46 TYR n 1 47 THR n 1 48 ARG n 1 49 GLU n 1 50 ALA n 1 51 GLY n 1 52 VAL n 1 53 ARG n 1 54 SER n 1 55 LEU n 1 56 GLU n 1 57 ARG n 1 58 GLN n 1 59 LEU n 1 60 ALA n 1 61 ALA n 1 62 ILE n 1 63 CYS n 1 64 ARG n 1 65 LYS n 1 66 ALA n 1 67 ALA n 1 68 LYS n 1 69 ALA n 1 70 ILE n 1 71 VAL n 1 72 ALA n 1 73 GLU n 1 74 GLU n 1 75 ARG n 1 76 LYS n 1 77 ARG n 1 78 ILE n 1 79 THR n 1 80 VAL n 1 81 THR n 1 82 GLU n 1 83 LYS n 1 84 ASN n 1 85 LEU n 1 86 GLN n 1 87 ASP n 1 88 PHE n 1 89 ILE n 1 90 GLY n 1 91 LYS n 1 92 ARG n 1 93 ILE n 1 94 PHE n 1 95 ARG n 1 96 TYR n 1 97 GLY n 1 98 GLN n 1 99 ALA n 1 100 GLU n 1 101 THR n 1 102 GLU n 1 103 ASP n 1 104 GLN n 1 105 VAL n 1 106 GLY n 1 107 VAL n 1 108 VAL n 1 109 THR n 1 110 GLY n 1 111 LEU n 1 112 ALA n 1 113 TYR n 1 114 THR n 1 115 THR n 1 116 VAL n 1 117 LEU n 1 118 ARG n 1 119 HIS n 1 120 HIS n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-21a(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LON1_BACSU _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAAKAIVAEERKRITVT EKNLQDFIGKRIFRYGQAETEDQVGVVTGLAYTTV ; _struct_ref.pdbx_align_begin 490 _struct_ref.pdbx_db_accession P37945 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X37 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P37945 _struct_ref_seq.db_align_beg 490 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 604 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 115 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X37 MET A 1 ? UNP P37945 ? ? 'initiating methionine' 0 1 1 1X37 LEU A 117 ? UNP P37945 ? ? 'expression tag' 116 2 1 1X37 ARG A 118 ? UNP P37945 ? ? 'expression tag' 117 3 1 1X37 HIS A 119 ? UNP P37945 ? ? 'expression tag' 118 4 1 1X37 HIS A 120 ? UNP P37945 ? ? 'expression tag' 119 5 1 1X37 HIS A 121 ? UNP P37945 ? ? 'expression tag' 120 6 1 1X37 HIS A 122 ? UNP P37945 ? ? 'expression tag' 121 7 1 1X37 HIS A 123 ? UNP P37945 ? ? 'expression tag' 122 8 1 1X37 HIS A 124 ? UNP P37945 ? ? 'expression tag' 123 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D TOCSY' 1 2 1 '2D NOESY' 1 3 1 3D_15N-separated_NOESY 1 4 1 3D_13C-separated_NOESY 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.5mM BsLonSSD U-15N, 13C; 50mM phosphate buffer with 100mM NaCl, 50mM Arg/Glu, 5mM DTT' '90% H2O/10% D2O' 2 '1.5mM BsLonSSD U-15N, 13C; 50mM phosphate buffer with 100mM NaCl, 50mM Arg/Glu, 5mM DTT' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 600 ? 2 AVANCE Bruker 800 ? # _pdbx_nmr_refine.entry_id 1X37 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 1157 restraints, 968 are NOE-derived distance constraints, 121 dihedral angle restraints,68 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1X37 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1X37 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 16 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X37 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing XwinNMR 3.5 Bruker 2 'data analysis' AURELIA 3.1.6 Bruker 3 processing NMRPipe ? 'Delaglio, F.' 4 'data analysis' NMRView 5.2.2 'Johnson, B. A.' 5 'structure solution' X-PLOR 3.851 'Brunger, A. T.' 6 refinement X-PLOR 3.851 'Brunger, A. T.' 7 # _exptl.entry_id 1X37 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X37 _struct.title 'Structure of Bacillus subtilis Lon protease SSD domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1X37 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'AAA+ superfamily, protease, SSD domain, solution structure, hydrolase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? LEU A 17 ? THR A 4 LEU A 16 1 ? 13 HELX_P HELX_P2 2 LEU A 18 ? LEU A 27 ? LEU A 17 LEU A 26 1 ? 10 HELX_P HELX_P3 3 ARG A 35 ? THR A 47 ? ARG A 34 THR A 46 1 ? 13 HELX_P HELX_P4 4 GLY A 51 ? ALA A 69 ? GLY A 50 ALA A 68 1 ? 19 HELX_P HELX_P5 5 ILE A 70 ? ALA A 72 ? ILE A 69 ALA A 71 5 ? 3 HELX_P HELX_P6 6 LYS A 83 ? GLY A 90 ? LYS A 82 GLY A 89 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 33 ? LEU A 34 ? GLN A 32 LEU A 33 A 2 THR A 79 ? VAL A 80 ? THR A 78 VAL A 79 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 33 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 32 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 80 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 79 # _database_PDB_matrix.entry_id 1X37 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X37 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 ALA 2 1 1 ALA ALA A . n A 1 3 GLY 3 2 2 GLY GLY A . n A 1 4 TYR 4 3 3 TYR TYR A . n A 1 5 THR 5 4 4 THR THR A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 ILE 7 6 6 ILE ILE A . n A 1 8 GLU 8 7 7 GLU GLU A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 VAL 13 12 12 VAL VAL A . n A 1 14 LYS 14 13 13 LYS LYS A . n A 1 15 ASP 15 14 14 ASP ASP A . n A 1 16 HIS 16 15 15 HIS HIS A . n A 1 17 LEU 17 16 16 LEU LEU A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 PRO 19 18 18 PRO PRO A . n A 1 20 LYS 20 19 19 LYS LYS A . n A 1 21 GLN 21 20 20 GLN GLN A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 LYS 23 22 22 LYS LYS A . n A 1 24 GLU 24 23 23 GLU GLU A . n A 1 25 HIS 25 24 24 HIS HIS A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 SER 30 29 29 SER SER A . n A 1 31 ASN 31 30 30 ASN ASN A . n A 1 32 LEU 32 31 31 LEU LEU A . n A 1 33 GLN 33 32 32 GLN GLN A . n A 1 34 LEU 34 33 33 LEU LEU A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 ASP 36 35 35 ASP ASP A . n A 1 37 GLN 37 36 36 GLN GLN A . n A 1 38 ALA 38 37 37 ALA ALA A . n A 1 39 ILE 39 38 38 ILE ILE A . n A 1 40 LEU 40 39 39 LEU LEU A . n A 1 41 ASP 41 40 40 ASP ASP A . n A 1 42 ILE 42 41 41 ILE ILE A . n A 1 43 ILE 43 42 42 ILE ILE A . n A 1 44 ARG 44 43 43 ARG ARG A . n A 1 45 TYR 45 44 44 TYR TYR A . n A 1 46 TYR 46 45 45 TYR TYR A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 ARG 48 47 47 ARG ARG A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 ALA 50 49 49 ALA ALA A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 VAL 52 51 51 VAL VAL A . n A 1 53 ARG 53 52 52 ARG ARG A . n A 1 54 SER 54 53 53 SER SER A . n A 1 55 LEU 55 54 54 LEU LEU A . n A 1 56 GLU 56 55 55 GLU GLU A . n A 1 57 ARG 57 56 56 ARG ARG A . n A 1 58 GLN 58 57 57 GLN GLN A . n A 1 59 LEU 59 58 58 LEU LEU A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 ALA 61 60 60 ALA ALA A . n A 1 62 ILE 62 61 61 ILE ILE A . n A 1 63 CYS 63 62 62 CYS CYS A . n A 1 64 ARG 64 63 63 ARG ARG A . n A 1 65 LYS 65 64 64 LYS LYS A . n A 1 66 ALA 66 65 65 ALA ALA A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 ALA 69 68 68 ALA ALA A . n A 1 70 ILE 70 69 69 ILE ILE A . n A 1 71 VAL 71 70 70 VAL VAL A . n A 1 72 ALA 72 71 71 ALA ALA A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 GLU 74 73 73 GLU GLU A . n A 1 75 ARG 75 74 74 ARG ARG A . n A 1 76 LYS 76 75 75 LYS LYS A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 ILE 78 77 77 ILE ILE A . n A 1 79 THR 79 78 78 THR THR A . n A 1 80 VAL 80 79 79 VAL VAL A . n A 1 81 THR 81 80 80 THR THR A . n A 1 82 GLU 82 81 81 GLU GLU A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 ASN 84 83 83 ASN ASN A . n A 1 85 LEU 85 84 84 LEU LEU A . n A 1 86 GLN 86 85 85 GLN GLN A . n A 1 87 ASP 87 86 86 ASP ASP A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 ILE 89 88 88 ILE ILE A . n A 1 90 GLY 90 89 89 GLY GLY A . n A 1 91 LYS 91 90 90 LYS LYS A . n A 1 92 ARG 92 91 91 ARG ARG A . n A 1 93 ILE 93 92 92 ILE ILE A . n A 1 94 PHE 94 93 93 PHE PHE A . n A 1 95 ARG 95 94 94 ARG ARG A . n A 1 96 TYR 96 95 95 TYR TYR A . n A 1 97 GLY 97 96 ? ? ? A . n A 1 98 GLN 98 97 ? ? ? A . n A 1 99 ALA 99 98 ? ? ? A . n A 1 100 GLU 100 99 ? ? ? A . n A 1 101 THR 101 100 ? ? ? A . n A 1 102 GLU 102 101 ? ? ? A . n A 1 103 ASP 103 102 ? ? ? A . n A 1 104 GLN 104 103 ? ? ? A . n A 1 105 VAL 105 104 ? ? ? A . n A 1 106 GLY 106 105 ? ? ? A . n A 1 107 VAL 107 106 ? ? ? A . n A 1 108 VAL 108 107 ? ? ? A . n A 1 109 THR 109 108 ? ? ? A . n A 1 110 GLY 110 109 ? ? ? A . n A 1 111 LEU 111 110 ? ? ? A . n A 1 112 ALA 112 111 ? ? ? A . n A 1 113 TYR 113 112 ? ? ? A . n A 1 114 THR 114 113 ? ? ? A . n A 1 115 THR 115 114 ? ? ? A . n A 1 116 VAL 116 115 ? ? ? A . n A 1 117 LEU 117 116 ? ? ? A . n A 1 118 ARG 118 117 ? ? ? A . n A 1 119 HIS 119 118 ? ? ? A . n A 1 120 HIS 120 119 ? ? ? A . n A 1 121 HIS 121 120 ? ? ? A . n A 1 122 HIS 122 121 ? ? ? A . n A 1 123 HIS 123 122 ? ? ? A . n A 1 124 HIS 124 123 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-10-30 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLN 85 ? ? H A GLY 89 ? ? 1.57 2 2 O A ILE 21 ? ? H A GLY 25 ? ? 1.55 3 3 HZ3 A LYS 28 ? ? H A LYS 75 ? ? 1.26 4 3 O A ALA 68 ? ? H A ALA 71 ? ? 1.45 5 3 O A ILE 21 ? ? H A GLY 25 ? ? 1.60 6 4 OE1 A GLU 48 ? ? H A GLY 50 ? ? 1.46 7 4 O A ILE 88 ? ? H A LYS 90 ? ? 1.50 8 5 OE1 A GLN 32 ? ? HE A ARG 76 ? ? 1.44 9 5 O A ILE 21 ? ? H A GLY 25 ? ? 1.53 10 5 O A ILE 21 ? ? N A GLY 25 ? ? 2.19 11 7 HG1 A THR 80 ? ? HD21 A ASN 83 ? ? 1.29 12 7 O A ILE 88 ? ? H A LYS 90 ? ? 1.52 13 7 O A ILE 21 ? ? H A GLY 25 ? ? 1.56 14 8 HZ1 A LYS 28 ? ? OE2 A GLU 72 ? ? 1.59 15 9 O A ILE 21 ? ? H A GLY 25 ? ? 1.47 16 9 O A ILE 88 ? ? H A LYS 90 ? ? 1.53 17 9 O A ILE 21 ? ? N A GLY 25 ? ? 2.14 18 10 O A ILE 21 ? ? H A GLY 25 ? ? 1.45 19 10 O A ILE 21 ? ? N A GLY 25 ? ? 2.15 20 11 O A ILE 21 ? ? H A GLY 25 ? ? 1.46 21 11 O A TYR 45 ? ? HG1 A THR 46 ? ? 1.50 22 11 O A TYR 45 ? ? H A ARG 47 ? ? 1.51 23 11 O A ALA 68 ? ? H A ALA 71 ? ? 1.57 24 11 O A ILE 21 ? ? N A GLY 25 ? ? 2.15 25 13 O A ILE 21 ? ? H A GLY 25 ? ? 1.58 26 14 HE22 A GLN 85 ? ? O A LYS 90 ? ? 1.46 27 14 O A ILE 21 ? ? H A GLY 25 ? ? 1.51 28 14 O A ILE 21 ? ? N A GLY 25 ? ? 2.14 29 16 O A ILE 21 ? ? H A GLY 25 ? ? 1.51 30 16 O A ILE 21 ? ? N A GLY 25 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 12 ? ? -38.79 -37.95 2 1 LYS A 19 ? ? -52.15 -79.43 3 1 LYS A 22 ? ? -71.35 -80.45 4 1 LEU A 26 ? ? -36.57 -39.78 5 1 LYS A 28 ? ? -39.78 139.31 6 1 SER A 29 ? ? -33.16 93.74 7 1 ASN A 30 ? ? -118.61 60.38 8 1 LEU A 31 ? ? -160.56 119.27 9 1 ILE A 41 ? ? -42.96 -71.76 10 1 THR A 46 ? ? 46.71 8.90 11 1 GLU A 48 ? ? 175.16 166.82 12 1 CYS A 62 ? ? -53.76 -71.65 13 1 LYS A 64 ? ? -39.92 -39.18 14 1 ALA A 68 ? ? -57.07 0.86 15 1 ILE A 69 ? ? -45.14 -9.89 16 1 VAL A 70 ? ? -89.23 31.37 17 1 GLU A 73 ? ? -168.86 5.87 18 1 ARG A 76 ? ? 55.67 105.48 19 1 VAL A 79 ? ? -111.88 65.61 20 1 THR A 80 ? ? -66.19 -168.94 21 1 LYS A 90 ? ? 80.34 157.02 22 2 VAL A 12 ? ? -39.30 -38.65 23 2 LEU A 16 ? ? -38.71 -37.78 24 2 LYS A 22 ? ? -67.75 -81.10 25 2 LEU A 26 ? ? -37.21 -39.65 26 2 LYS A 28 ? ? -46.99 158.28 27 2 SER A 29 ? ? -45.53 91.64 28 2 ILE A 41 ? ? -43.57 -77.06 29 2 ILE A 42 ? ? -39.88 -39.17 30 2 THR A 46 ? ? 51.07 10.17 31 2 GLU A 48 ? ? -92.55 -98.32 32 2 CYS A 62 ? ? -56.77 -70.24 33 2 VAL A 70 ? ? -64.69 4.72 34 2 ALA A 71 ? ? -58.40 -160.08 35 2 GLU A 72 ? ? -54.31 -77.54 36 2 ARG A 74 ? ? -87.65 33.46 37 2 ARG A 76 ? ? 50.04 81.69 38 2 PHE A 87 ? ? -79.56 -71.15 39 2 LYS A 90 ? ? -168.95 85.63 40 2 ILE A 92 ? ? -135.72 -41.01 41 3 VAL A 12 ? ? -39.20 -38.90 42 3 LEU A 16 ? ? -39.95 -38.98 43 3 LYS A 19 ? ? -48.97 -70.49 44 3 LYS A 22 ? ? -68.84 -81.17 45 3 LEU A 26 ? ? -36.95 -39.52 46 3 LYS A 28 ? ? -46.03 154.56 47 3 SER A 29 ? ? -46.08 92.99 48 3 ASN A 30 ? ? -113.06 59.03 49 3 TYR A 45 ? ? -89.24 -70.76 50 3 THR A 46 ? ? 49.54 12.80 51 3 ALA A 49 ? ? -144.40 54.35 52 3 ALA A 68 ? ? -54.02 -6.18 53 3 ILE A 69 ? ? -47.74 -17.54 54 3 GLU A 73 ? ? -164.42 66.28 55 3 LYS A 75 ? ? 74.37 92.02 56 3 ARG A 76 ? ? 46.15 100.07 57 3 LYS A 90 ? ? -173.14 109.58 58 3 ILE A 92 ? ? -123.49 -54.90 59 4 VAL A 12 ? ? -39.09 -38.30 60 4 LEU A 16 ? ? -38.12 -37.90 61 4 LYS A 22 ? ? -70.46 -81.13 62 4 LEU A 26 ? ? -37.49 -39.80 63 4 LYS A 28 ? ? -46.60 156.17 64 4 SER A 29 ? ? -46.54 91.86 65 4 ASN A 30 ? ? -113.25 61.47 66 4 ALA A 37 ? ? -54.58 -74.62 67 4 TYR A 45 ? ? -157.41 61.52 68 4 ARG A 47 ? ? -32.83 126.52 69 4 GLU A 48 ? ? -172.87 -179.12 70 4 ALA A 49 ? ? -146.90 40.42 71 4 ALA A 68 ? ? -53.88 -6.47 72 4 ALA A 71 ? ? -65.41 73.64 73 4 GLU A 73 ? ? 51.74 89.60 74 4 ARG A 76 ? ? 47.60 92.45 75 4 THR A 80 ? ? -105.20 -147.74 76 4 ILE A 92 ? ? -110.12 -73.77 77 4 PHE A 93 ? ? -63.10 89.80 78 5 VAL A 12 ? ? -39.50 -37.92 79 5 LEU A 16 ? ? -39.45 -37.30 80 5 LYS A 19 ? ? -45.40 -77.17 81 5 LYS A 22 ? ? -67.61 -80.74 82 5 LEU A 26 ? ? -37.79 -39.66 83 5 LYS A 28 ? ? -48.28 157.62 84 5 SER A 29 ? ? -44.54 94.45 85 5 ASN A 30 ? ? -111.63 50.08 86 5 ALA A 37 ? ? -55.13 -73.04 87 5 ILE A 41 ? ? -47.13 -75.48 88 5 GLU A 48 ? ? -96.40 -88.18 89 5 ALA A 68 ? ? -53.47 -4.44 90 5 ALA A 71 ? ? -69.36 95.78 91 5 GLU A 72 ? ? 59.21 111.78 92 5 GLU A 73 ? ? -53.71 88.49 93 5 ARG A 76 ? ? 58.15 112.74 94 5 THR A 80 ? ? -93.84 -131.40 95 5 ILE A 92 ? ? -140.56 -43.31 96 6 VAL A 12 ? ? -39.55 -38.20 97 6 LEU A 16 ? ? -40.00 -39.31 98 6 LYS A 19 ? ? -50.00 -74.07 99 6 LYS A 22 ? ? -70.48 -80.94 100 6 LEU A 26 ? ? -36.41 -39.37 101 6 SER A 29 ? ? -35.46 95.62 102 6 GLN A 32 ? ? -153.87 84.84 103 6 ILE A 41 ? ? -51.67 -80.37 104 6 TYR A 45 ? ? -83.71 -70.92 105 6 THR A 46 ? ? 47.84 11.58 106 6 GLU A 48 ? ? 60.46 116.31 107 6 CYS A 62 ? ? -58.11 -74.08 108 6 ALA A 68 ? ? -54.24 -4.80 109 6 ILE A 69 ? ? -59.60 -3.73 110 6 ALA A 71 ? ? -56.26 170.19 111 6 GLU A 72 ? ? -61.13 -115.46 112 6 ARG A 74 ? ? -169.54 88.05 113 6 ARG A 76 ? ? 47.44 97.58 114 6 PHE A 87 ? ? -79.78 -78.15 115 6 LYS A 90 ? ? 72.23 -170.06 116 6 ARG A 91 ? ? -172.14 -156.80 117 6 ILE A 92 ? ? -130.74 -74.20 118 7 VAL A 12 ? ? -38.93 -38.60 119 7 LEU A 16 ? ? -38.23 -38.32 120 7 LYS A 19 ? ? -46.94 -77.42 121 7 LYS A 22 ? ? -68.16 -80.76 122 7 LEU A 26 ? ? -37.53 -39.45 123 7 LYS A 28 ? ? -44.19 153.83 124 7 SER A 29 ? ? -41.04 95.45 125 7 LEU A 31 ? ? -161.47 117.66 126 7 ILE A 41 ? ? -58.57 -76.21 127 7 ALA A 49 ? ? -172.92 42.79 128 7 ALA A 68 ? ? -59.93 3.22 129 7 ILE A 69 ? ? -59.93 -1.85 130 7 ARG A 74 ? ? -49.20 165.71 131 7 LYS A 75 ? ? -78.61 -165.30 132 7 ARG A 76 ? ? 50.55 89.09 133 7 THR A 80 ? ? -142.88 -151.93 134 7 ILE A 92 ? ? -131.49 -46.27 135 7 ARG A 94 ? ? -106.94 65.04 136 8 VAL A 12 ? ? -39.33 -38.36 137 8 LEU A 16 ? ? -38.76 -37.33 138 8 LYS A 22 ? ? -69.47 -80.89 139 8 LEU A 26 ? ? -38.33 -39.71 140 8 LYS A 28 ? ? -46.73 155.49 141 8 SER A 29 ? ? -43.13 95.10 142 8 LEU A 31 ? ? -161.34 119.03 143 8 TYR A 45 ? ? -93.72 -74.34 144 8 THR A 46 ? ? 51.44 8.95 145 8 GLU A 48 ? ? 55.03 172.76 146 8 ALA A 49 ? ? -142.77 49.47 147 8 ALA A 68 ? ? -57.07 -5.39 148 8 ILE A 69 ? ? -77.88 26.73 149 8 VAL A 70 ? ? -46.09 -18.79 150 8 ALA A 71 ? ? -89.22 -152.67 151 8 GLU A 72 ? ? -171.78 23.11 152 8 ARG A 74 ? ? -172.19 104.03 153 8 ARG A 76 ? ? 55.91 111.45 154 8 LEU A 84 ? ? -41.59 -72.06 155 8 ILE A 88 ? ? -80.72 -78.92 156 8 LYS A 90 ? ? -124.42 -160.97 157 8 ARG A 91 ? ? -156.23 -145.26 158 8 ILE A 92 ? ? -136.74 -44.72 159 8 ARG A 94 ? ? -107.22 70.29 160 9 VAL A 12 ? ? -38.91 -38.31 161 9 LEU A 16 ? ? -38.02 -37.96 162 9 LYS A 19 ? ? -43.79 -71.06 163 9 LYS A 22 ? ? -65.44 -80.75 164 9 LEU A 26 ? ? -37.11 -39.63 165 9 LYS A 28 ? ? -45.30 153.78 166 9 SER A 29 ? ? -41.36 95.08 167 9 ALA A 37 ? ? -54.15 -71.36 168 9 ILE A 41 ? ? -58.68 -72.48 169 9 TYR A 45 ? ? -87.99 -70.20 170 9 THR A 46 ? ? 54.73 7.95 171 9 ALA A 49 ? ? 172.51 33.45 172 9 ALA A 68 ? ? -49.00 -9.91 173 9 ILE A 69 ? ? -46.07 -15.47 174 9 VAL A 70 ? ? -46.91 -14.24 175 9 ALA A 71 ? ? -85.40 -158.45 176 9 GLU A 73 ? ? -68.63 89.34 177 9 LYS A 75 ? ? 50.79 -161.83 178 9 THR A 80 ? ? -128.52 -153.07 179 9 ARG A 91 ? ? -103.12 -159.38 180 9 ILE A 92 ? ? -142.03 -47.13 181 9 ARG A 94 ? ? -69.37 90.99 182 10 VAL A 12 ? ? -39.34 -38.07 183 10 LEU A 16 ? ? -39.72 -37.30 184 10 LYS A 19 ? ? -49.24 -80.10 185 10 LYS A 22 ? ? -64.28 -81.19 186 10 LEU A 26 ? ? -37.33 -39.51 187 10 LYS A 28 ? ? -46.25 155.14 188 10 SER A 29 ? ? -45.95 93.47 189 10 ASN A 30 ? ? -114.44 57.96 190 10 ALA A 37 ? ? -60.09 -74.43 191 10 ILE A 41 ? ? -48.82 -80.95 192 10 TYR A 45 ? ? -86.67 -71.46 193 10 THR A 46 ? ? 58.22 -7.43 194 10 ARG A 47 ? ? -69.17 72.42 195 10 ALA A 49 ? ? -143.60 41.52 196 10 ALA A 68 ? ? -49.91 -10.94 197 10 ALA A 71 ? ? -69.94 -147.59 198 10 GLU A 73 ? ? -49.32 94.61 199 10 ARG A 76 ? ? 49.46 97.17 200 10 THR A 80 ? ? -126.96 -90.77 201 10 GLU A 81 ? ? -143.29 -29.04 202 10 ARG A 91 ? ? -131.65 -156.98 203 10 ILE A 92 ? ? -136.75 -55.10 204 11 THR A 4 ? ? -110.52 -141.94 205 11 VAL A 12 ? ? -39.76 -39.59 206 11 LEU A 16 ? ? -38.10 -37.40 207 11 LYS A 22 ? ? -64.42 -81.09 208 11 LEU A 26 ? ? -37.60 -39.37 209 11 LYS A 28 ? ? -43.43 156.24 210 11 SER A 29 ? ? -43.71 93.48 211 11 ALA A 37 ? ? -52.88 -72.05 212 11 ILE A 41 ? ? -48.03 -80.56 213 11 THR A 46 ? ? 68.68 -43.52 214 11 GLU A 48 ? ? -173.44 -50.78 215 11 ALA A 49 ? ? 49.03 18.78 216 11 ALA A 68 ? ? -58.36 -0.47 217 11 ALA A 71 ? ? -72.94 -148.97 218 11 GLU A 73 ? ? -156.95 -51.27 219 11 ARG A 74 ? ? 52.62 5.77 220 11 PHE A 87 ? ? -80.04 -72.08 221 12 VAL A 12 ? ? -38.76 -38.39 222 12 HIS A 15 ? ? -39.83 -39.14 223 12 LYS A 22 ? ? -68.41 -81.18 224 12 LEU A 26 ? ? -37.17 -39.28 225 12 LYS A 28 ? ? -45.22 159.80 226 12 SER A 29 ? ? -43.51 95.67 227 12 LEU A 31 ? ? -160.97 111.81 228 12 THR A 46 ? ? 52.80 5.30 229 12 ALA A 49 ? ? 173.57 62.16 230 12 CYS A 62 ? ? -57.63 -76.75 231 12 ALA A 68 ? ? -47.05 -16.81 232 12 GLU A 72 ? ? 48.42 95.25 233 12 GLU A 73 ? ? -129.03 -98.02 234 12 ARG A 76 ? ? 47.52 79.61 235 12 LYS A 90 ? ? 59.56 94.81 236 13 VAL A 12 ? ? -39.20 -38.36 237 13 LEU A 16 ? ? -38.61 -37.31 238 13 LYS A 22 ? ? -68.33 -80.93 239 13 LEU A 26 ? ? -37.21 -39.66 240 13 SER A 29 ? ? -41.22 94.62 241 13 GLN A 32 ? ? -153.47 77.57 242 13 TYR A 45 ? ? -96.54 32.03 243 13 THR A 46 ? ? -44.25 -19.90 244 13 ARG A 47 ? ? -56.71 87.98 245 13 ALA A 49 ? ? -143.73 58.60 246 13 CYS A 62 ? ? -55.29 -70.55 247 13 ALA A 68 ? ? -60.59 4.40 248 13 ILE A 69 ? ? -69.30 30.37 249 13 VAL A 70 ? ? -50.52 -9.73 250 13 ALA A 71 ? ? -60.18 -145.55 251 13 GLU A 72 ? ? -130.76 -58.15 252 13 LYS A 75 ? ? -67.32 -170.33 253 13 PHE A 87 ? ? -80.35 -72.19 254 14 VAL A 12 ? ? -39.37 -38.79 255 14 ASP A 14 ? ? -64.57 -72.16 256 14 HIS A 15 ? ? -39.38 -36.67 257 14 LEU A 16 ? ? -36.63 -39.98 258 14 LEU A 17 ? ? -80.74 -70.23 259 14 LYS A 22 ? ? -66.22 -81.26 260 14 LYS A 28 ? ? -40.55 167.60 261 14 ASN A 30 ? ? -144.72 36.71 262 14 LEU A 31 ? ? -161.17 111.71 263 14 ALA A 37 ? ? -55.96 -78.81 264 14 ILE A 41 ? ? -47.31 -73.21 265 14 TYR A 45 ? ? -89.81 -71.59 266 14 THR A 46 ? ? 49.24 12.65 267 14 ALA A 49 ? ? -140.64 28.50 268 14 ALA A 68 ? ? -54.13 -7.47 269 14 ILE A 69 ? ? -49.54 -13.69 270 14 ALA A 71 ? ? -61.44 -158.72 271 14 ARG A 74 ? ? -150.82 -19.41 272 14 LYS A 75 ? ? 52.76 175.29 273 14 ARG A 76 ? ? 56.45 99.74 274 14 THR A 80 ? ? -105.33 -121.54 275 15 VAL A 12 ? ? -39.26 -38.70 276 15 ASP A 14 ? ? -72.51 -72.50 277 15 HIS A 15 ? ? -39.67 -36.04 278 15 LEU A 17 ? ? -80.42 -70.61 279 15 LYS A 22 ? ? -69.91 -81.31 280 15 LEU A 26 ? ? -35.91 -39.04 281 15 LYS A 28 ? ? -41.40 155.73 282 15 SER A 29 ? ? -40.94 95.50 283 15 ALA A 37 ? ? -60.46 -72.65 284 15 THR A 46 ? ? 48.13 12.31 285 15 ARG A 47 ? ? -98.59 42.76 286 15 CYS A 62 ? ? -54.66 -71.73 287 15 ALA A 68 ? ? -52.71 -7.63 288 15 VAL A 70 ? ? -55.80 -7.07 289 15 ALA A 71 ? ? -74.05 -152.10 290 15 GLU A 72 ? ? -74.53 47.90 291 15 GLU A 73 ? ? 52.16 -86.71 292 15 ARG A 74 ? ? 70.14 -39.81 293 15 LYS A 75 ? ? 58.93 157.44 294 15 ARG A 76 ? ? 46.97 88.21 295 15 ILE A 92 ? ? -98.19 -75.80 296 15 ARG A 94 ? ? -108.86 76.83 297 16 VAL A 12 ? ? -39.05 -38.46 298 16 LEU A 16 ? ? -38.63 -38.12 299 16 LYS A 22 ? ? -66.98 -80.57 300 16 LEU A 26 ? ? -37.81 -39.55 301 16 LYS A 28 ? ? -46.63 155.78 302 16 SER A 29 ? ? -45.13 93.76 303 16 ASN A 30 ? ? -114.15 56.01 304 16 LEU A 31 ? ? -161.01 116.96 305 16 ALA A 37 ? ? -47.68 -79.97 306 16 ILE A 41 ? ? -52.51 -75.82 307 16 TYR A 45 ? ? -162.94 65.72 308 16 ARG A 47 ? ? 30.90 57.27 309 16 ALA A 49 ? ? -100.16 53.79 310 16 CYS A 62 ? ? -54.15 -71.96 311 16 ALA A 68 ? ? -68.58 7.47 312 16 GLU A 72 ? ? 48.42 -162.23 313 16 ARG A 74 ? ? -107.03 74.14 314 16 THR A 80 ? ? -88.84 -89.52 315 16 GLU A 81 ? ? -150.27 32.58 316 16 LYS A 82 ? ? -148.82 -47.10 317 16 ILE A 92 ? ? -100.88 -69.05 318 16 PHE A 93 ? ? -65.10 93.64 319 16 ARG A 94 ? ? -101.42 71.28 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A GLY 96 ? A GLY 97 3 1 Y 1 A GLN 97 ? A GLN 98 4 1 Y 1 A ALA 98 ? A ALA 99 5 1 Y 1 A GLU 99 ? A GLU 100 6 1 Y 1 A THR 100 ? A THR 101 7 1 Y 1 A GLU 101 ? A GLU 102 8 1 Y 1 A ASP 102 ? A ASP 103 9 1 Y 1 A GLN 103 ? A GLN 104 10 1 Y 1 A VAL 104 ? A VAL 105 11 1 Y 1 A GLY 105 ? A GLY 106 12 1 Y 1 A VAL 106 ? A VAL 107 13 1 Y 1 A VAL 107 ? A VAL 108 14 1 Y 1 A THR 108 ? A THR 109 15 1 Y 1 A GLY 109 ? A GLY 110 16 1 Y 1 A LEU 110 ? A LEU 111 17 1 Y 1 A ALA 111 ? A ALA 112 18 1 Y 1 A TYR 112 ? A TYR 113 19 1 Y 1 A THR 113 ? A THR 114 20 1 Y 1 A THR 114 ? A THR 115 21 1 Y 1 A VAL 115 ? A VAL 116 22 1 Y 1 A LEU 116 ? A LEU 117 23 1 Y 1 A ARG 117 ? A ARG 118 24 1 Y 1 A HIS 118 ? A HIS 119 25 1 Y 1 A HIS 119 ? A HIS 120 26 1 Y 1 A HIS 120 ? A HIS 121 27 1 Y 1 A HIS 121 ? A HIS 122 28 1 Y 1 A HIS 122 ? A HIS 123 29 1 Y 1 A HIS 123 ? A HIS 124 30 2 Y 1 A MET 0 ? A MET 1 31 2 Y 1 A GLY 96 ? A GLY 97 32 2 Y 1 A GLN 97 ? A GLN 98 33 2 Y 1 A ALA 98 ? A ALA 99 34 2 Y 1 A GLU 99 ? A GLU 100 35 2 Y 1 A THR 100 ? A THR 101 36 2 Y 1 A GLU 101 ? A GLU 102 37 2 Y 1 A ASP 102 ? A ASP 103 38 2 Y 1 A GLN 103 ? A GLN 104 39 2 Y 1 A VAL 104 ? A VAL 105 40 2 Y 1 A GLY 105 ? A GLY 106 41 2 Y 1 A VAL 106 ? A VAL 107 42 2 Y 1 A VAL 107 ? A VAL 108 43 2 Y 1 A THR 108 ? A THR 109 44 2 Y 1 A GLY 109 ? A GLY 110 45 2 Y 1 A LEU 110 ? A LEU 111 46 2 Y 1 A ALA 111 ? A ALA 112 47 2 Y 1 A TYR 112 ? A TYR 113 48 2 Y 1 A THR 113 ? A THR 114 49 2 Y 1 A THR 114 ? A THR 115 50 2 Y 1 A VAL 115 ? A VAL 116 51 2 Y 1 A LEU 116 ? A LEU 117 52 2 Y 1 A ARG 117 ? A ARG 118 53 2 Y 1 A HIS 118 ? A HIS 119 54 2 Y 1 A HIS 119 ? A HIS 120 55 2 Y 1 A HIS 120 ? A HIS 121 56 2 Y 1 A HIS 121 ? A HIS 122 57 2 Y 1 A HIS 122 ? A HIS 123 58 2 Y 1 A HIS 123 ? A HIS 124 59 3 Y 1 A MET 0 ? A MET 1 60 3 Y 1 A GLY 96 ? A GLY 97 61 3 Y 1 A GLN 97 ? A GLN 98 62 3 Y 1 A ALA 98 ? A ALA 99 63 3 Y 1 A GLU 99 ? A GLU 100 64 3 Y 1 A THR 100 ? A THR 101 65 3 Y 1 A GLU 101 ? A GLU 102 66 3 Y 1 A ASP 102 ? A ASP 103 67 3 Y 1 A GLN 103 ? A GLN 104 68 3 Y 1 A VAL 104 ? A VAL 105 69 3 Y 1 A GLY 105 ? A GLY 106 70 3 Y 1 A VAL 106 ? A VAL 107 71 3 Y 1 A VAL 107 ? A VAL 108 72 3 Y 1 A THR 108 ? A THR 109 73 3 Y 1 A GLY 109 ? A GLY 110 74 3 Y 1 A LEU 110 ? A LEU 111 75 3 Y 1 A ALA 111 ? A ALA 112 76 3 Y 1 A TYR 112 ? A TYR 113 77 3 Y 1 A THR 113 ? A THR 114 78 3 Y 1 A THR 114 ? A THR 115 79 3 Y 1 A VAL 115 ? A VAL 116 80 3 Y 1 A LEU 116 ? A LEU 117 81 3 Y 1 A ARG 117 ? A ARG 118 82 3 Y 1 A HIS 118 ? A HIS 119 83 3 Y 1 A HIS 119 ? A HIS 120 84 3 Y 1 A HIS 120 ? A HIS 121 85 3 Y 1 A HIS 121 ? A HIS 122 86 3 Y 1 A HIS 122 ? A HIS 123 87 3 Y 1 A HIS 123 ? A HIS 124 88 4 Y 1 A MET 0 ? A MET 1 89 4 Y 1 A GLY 96 ? A GLY 97 90 4 Y 1 A GLN 97 ? A GLN 98 91 4 Y 1 A ALA 98 ? A ALA 99 92 4 Y 1 A GLU 99 ? A GLU 100 93 4 Y 1 A THR 100 ? A THR 101 94 4 Y 1 A GLU 101 ? A GLU 102 95 4 Y 1 A ASP 102 ? A ASP 103 96 4 Y 1 A GLN 103 ? A GLN 104 97 4 Y 1 A VAL 104 ? A VAL 105 98 4 Y 1 A GLY 105 ? A GLY 106 99 4 Y 1 A VAL 106 ? A VAL 107 100 4 Y 1 A VAL 107 ? A VAL 108 101 4 Y 1 A THR 108 ? A THR 109 102 4 Y 1 A GLY 109 ? A GLY 110 103 4 Y 1 A LEU 110 ? A LEU 111 104 4 Y 1 A ALA 111 ? A ALA 112 105 4 Y 1 A TYR 112 ? A TYR 113 106 4 Y 1 A THR 113 ? A THR 114 107 4 Y 1 A THR 114 ? A THR 115 108 4 Y 1 A VAL 115 ? A VAL 116 109 4 Y 1 A LEU 116 ? A LEU 117 110 4 Y 1 A ARG 117 ? A ARG 118 111 4 Y 1 A HIS 118 ? A HIS 119 112 4 Y 1 A HIS 119 ? A HIS 120 113 4 Y 1 A HIS 120 ? A HIS 121 114 4 Y 1 A HIS 121 ? A HIS 122 115 4 Y 1 A HIS 122 ? A HIS 123 116 4 Y 1 A HIS 123 ? A HIS 124 117 5 Y 1 A MET 0 ? A MET 1 118 5 Y 1 A GLY 96 ? A GLY 97 119 5 Y 1 A GLN 97 ? A GLN 98 120 5 Y 1 A ALA 98 ? A ALA 99 121 5 Y 1 A GLU 99 ? A GLU 100 122 5 Y 1 A THR 100 ? A THR 101 123 5 Y 1 A GLU 101 ? A GLU 102 124 5 Y 1 A ASP 102 ? A ASP 103 125 5 Y 1 A GLN 103 ? A GLN 104 126 5 Y 1 A VAL 104 ? A VAL 105 127 5 Y 1 A GLY 105 ? A GLY 106 128 5 Y 1 A VAL 106 ? A VAL 107 129 5 Y 1 A VAL 107 ? A VAL 108 130 5 Y 1 A THR 108 ? A THR 109 131 5 Y 1 A GLY 109 ? A GLY 110 132 5 Y 1 A LEU 110 ? A LEU 111 133 5 Y 1 A ALA 111 ? A ALA 112 134 5 Y 1 A TYR 112 ? A TYR 113 135 5 Y 1 A THR 113 ? A THR 114 136 5 Y 1 A THR 114 ? A THR 115 137 5 Y 1 A VAL 115 ? A VAL 116 138 5 Y 1 A LEU 116 ? A LEU 117 139 5 Y 1 A ARG 117 ? A ARG 118 140 5 Y 1 A HIS 118 ? A HIS 119 141 5 Y 1 A HIS 119 ? A HIS 120 142 5 Y 1 A HIS 120 ? A HIS 121 143 5 Y 1 A HIS 121 ? A HIS 122 144 5 Y 1 A HIS 122 ? A HIS 123 145 5 Y 1 A HIS 123 ? A HIS 124 146 6 Y 1 A MET 0 ? A MET 1 147 6 Y 1 A GLY 96 ? A GLY 97 148 6 Y 1 A GLN 97 ? A GLN 98 149 6 Y 1 A ALA 98 ? A ALA 99 150 6 Y 1 A GLU 99 ? A GLU 100 151 6 Y 1 A THR 100 ? A THR 101 152 6 Y 1 A GLU 101 ? A GLU 102 153 6 Y 1 A ASP 102 ? A ASP 103 154 6 Y 1 A GLN 103 ? A GLN 104 155 6 Y 1 A VAL 104 ? A VAL 105 156 6 Y 1 A GLY 105 ? A GLY 106 157 6 Y 1 A VAL 106 ? A VAL 107 158 6 Y 1 A VAL 107 ? A VAL 108 159 6 Y 1 A THR 108 ? A THR 109 160 6 Y 1 A GLY 109 ? A GLY 110 161 6 Y 1 A LEU 110 ? A LEU 111 162 6 Y 1 A ALA 111 ? A ALA 112 163 6 Y 1 A TYR 112 ? A TYR 113 164 6 Y 1 A THR 113 ? A THR 114 165 6 Y 1 A THR 114 ? A THR 115 166 6 Y 1 A VAL 115 ? A VAL 116 167 6 Y 1 A LEU 116 ? A LEU 117 168 6 Y 1 A ARG 117 ? A ARG 118 169 6 Y 1 A HIS 118 ? A HIS 119 170 6 Y 1 A HIS 119 ? A HIS 120 171 6 Y 1 A HIS 120 ? A HIS 121 172 6 Y 1 A HIS 121 ? A HIS 122 173 6 Y 1 A HIS 122 ? A HIS 123 174 6 Y 1 A HIS 123 ? A HIS 124 175 7 Y 1 A MET 0 ? A MET 1 176 7 Y 1 A GLY 96 ? A GLY 97 177 7 Y 1 A GLN 97 ? A GLN 98 178 7 Y 1 A ALA 98 ? A ALA 99 179 7 Y 1 A GLU 99 ? A GLU 100 180 7 Y 1 A THR 100 ? A THR 101 181 7 Y 1 A GLU 101 ? A GLU 102 182 7 Y 1 A ASP 102 ? A ASP 103 183 7 Y 1 A GLN 103 ? A GLN 104 184 7 Y 1 A VAL 104 ? A VAL 105 185 7 Y 1 A GLY 105 ? A GLY 106 186 7 Y 1 A VAL 106 ? A VAL 107 187 7 Y 1 A VAL 107 ? A VAL 108 188 7 Y 1 A THR 108 ? A THR 109 189 7 Y 1 A GLY 109 ? A GLY 110 190 7 Y 1 A LEU 110 ? A LEU 111 191 7 Y 1 A ALA 111 ? A ALA 112 192 7 Y 1 A TYR 112 ? A TYR 113 193 7 Y 1 A THR 113 ? A THR 114 194 7 Y 1 A THR 114 ? A THR 115 195 7 Y 1 A VAL 115 ? A VAL 116 196 7 Y 1 A LEU 116 ? A LEU 117 197 7 Y 1 A ARG 117 ? A ARG 118 198 7 Y 1 A HIS 118 ? A HIS 119 199 7 Y 1 A HIS 119 ? A HIS 120 200 7 Y 1 A HIS 120 ? A HIS 121 201 7 Y 1 A HIS 121 ? A HIS 122 202 7 Y 1 A HIS 122 ? A HIS 123 203 7 Y 1 A HIS 123 ? A HIS 124 204 8 Y 1 A MET 0 ? A MET 1 205 8 Y 1 A GLY 96 ? A GLY 97 206 8 Y 1 A GLN 97 ? A GLN 98 207 8 Y 1 A ALA 98 ? A ALA 99 208 8 Y 1 A GLU 99 ? A GLU 100 209 8 Y 1 A THR 100 ? A THR 101 210 8 Y 1 A GLU 101 ? A GLU 102 211 8 Y 1 A ASP 102 ? A ASP 103 212 8 Y 1 A GLN 103 ? A GLN 104 213 8 Y 1 A VAL 104 ? A VAL 105 214 8 Y 1 A GLY 105 ? A GLY 106 215 8 Y 1 A VAL 106 ? A VAL 107 216 8 Y 1 A VAL 107 ? A VAL 108 217 8 Y 1 A THR 108 ? A THR 109 218 8 Y 1 A GLY 109 ? A GLY 110 219 8 Y 1 A LEU 110 ? A LEU 111 220 8 Y 1 A ALA 111 ? A ALA 112 221 8 Y 1 A TYR 112 ? A TYR 113 222 8 Y 1 A THR 113 ? A THR 114 223 8 Y 1 A THR 114 ? A THR 115 224 8 Y 1 A VAL 115 ? A VAL 116 225 8 Y 1 A LEU 116 ? A LEU 117 226 8 Y 1 A ARG 117 ? A ARG 118 227 8 Y 1 A HIS 118 ? A HIS 119 228 8 Y 1 A HIS 119 ? A HIS 120 229 8 Y 1 A HIS 120 ? A HIS 121 230 8 Y 1 A HIS 121 ? A HIS 122 231 8 Y 1 A HIS 122 ? A HIS 123 232 8 Y 1 A HIS 123 ? A HIS 124 233 9 Y 1 A MET 0 ? A MET 1 234 9 Y 1 A GLY 96 ? A GLY 97 235 9 Y 1 A GLN 97 ? A GLN 98 236 9 Y 1 A ALA 98 ? A ALA 99 237 9 Y 1 A GLU 99 ? A GLU 100 238 9 Y 1 A THR 100 ? A THR 101 239 9 Y 1 A GLU 101 ? A GLU 102 240 9 Y 1 A ASP 102 ? A ASP 103 241 9 Y 1 A GLN 103 ? A GLN 104 242 9 Y 1 A VAL 104 ? A VAL 105 243 9 Y 1 A GLY 105 ? A GLY 106 244 9 Y 1 A VAL 106 ? A VAL 107 245 9 Y 1 A VAL 107 ? A VAL 108 246 9 Y 1 A THR 108 ? A THR 109 247 9 Y 1 A GLY 109 ? A GLY 110 248 9 Y 1 A LEU 110 ? A LEU 111 249 9 Y 1 A ALA 111 ? A ALA 112 250 9 Y 1 A TYR 112 ? A TYR 113 251 9 Y 1 A THR 113 ? A THR 114 252 9 Y 1 A THR 114 ? A THR 115 253 9 Y 1 A VAL 115 ? A VAL 116 254 9 Y 1 A LEU 116 ? A LEU 117 255 9 Y 1 A ARG 117 ? A ARG 118 256 9 Y 1 A HIS 118 ? A HIS 119 257 9 Y 1 A HIS 119 ? A HIS 120 258 9 Y 1 A HIS 120 ? A HIS 121 259 9 Y 1 A HIS 121 ? A HIS 122 260 9 Y 1 A HIS 122 ? A HIS 123 261 9 Y 1 A HIS 123 ? A HIS 124 262 10 Y 1 A MET 0 ? A MET 1 263 10 Y 1 A GLY 96 ? A GLY 97 264 10 Y 1 A GLN 97 ? A GLN 98 265 10 Y 1 A ALA 98 ? A ALA 99 266 10 Y 1 A GLU 99 ? A GLU 100 267 10 Y 1 A THR 100 ? A THR 101 268 10 Y 1 A GLU 101 ? A GLU 102 269 10 Y 1 A ASP 102 ? A ASP 103 270 10 Y 1 A GLN 103 ? A GLN 104 271 10 Y 1 A VAL 104 ? A VAL 105 272 10 Y 1 A GLY 105 ? A GLY 106 273 10 Y 1 A VAL 106 ? A VAL 107 274 10 Y 1 A VAL 107 ? A VAL 108 275 10 Y 1 A THR 108 ? A THR 109 276 10 Y 1 A GLY 109 ? A GLY 110 277 10 Y 1 A LEU 110 ? A LEU 111 278 10 Y 1 A ALA 111 ? A ALA 112 279 10 Y 1 A TYR 112 ? A TYR 113 280 10 Y 1 A THR 113 ? A THR 114 281 10 Y 1 A THR 114 ? A THR 115 282 10 Y 1 A VAL 115 ? A VAL 116 283 10 Y 1 A LEU 116 ? A LEU 117 284 10 Y 1 A ARG 117 ? A ARG 118 285 10 Y 1 A HIS 118 ? A HIS 119 286 10 Y 1 A HIS 119 ? A HIS 120 287 10 Y 1 A HIS 120 ? A HIS 121 288 10 Y 1 A HIS 121 ? A HIS 122 289 10 Y 1 A HIS 122 ? A HIS 123 290 10 Y 1 A HIS 123 ? A HIS 124 291 11 Y 1 A MET 0 ? A MET 1 292 11 Y 1 A GLY 96 ? A GLY 97 293 11 Y 1 A GLN 97 ? A GLN 98 294 11 Y 1 A ALA 98 ? A ALA 99 295 11 Y 1 A GLU 99 ? A GLU 100 296 11 Y 1 A THR 100 ? A THR 101 297 11 Y 1 A GLU 101 ? A GLU 102 298 11 Y 1 A ASP 102 ? A ASP 103 299 11 Y 1 A GLN 103 ? A GLN 104 300 11 Y 1 A VAL 104 ? A VAL 105 301 11 Y 1 A GLY 105 ? A GLY 106 302 11 Y 1 A VAL 106 ? A VAL 107 303 11 Y 1 A VAL 107 ? A VAL 108 304 11 Y 1 A THR 108 ? A THR 109 305 11 Y 1 A GLY 109 ? A GLY 110 306 11 Y 1 A LEU 110 ? A LEU 111 307 11 Y 1 A ALA 111 ? A ALA 112 308 11 Y 1 A TYR 112 ? A TYR 113 309 11 Y 1 A THR 113 ? A THR 114 310 11 Y 1 A THR 114 ? A THR 115 311 11 Y 1 A VAL 115 ? A VAL 116 312 11 Y 1 A LEU 116 ? A LEU 117 313 11 Y 1 A ARG 117 ? A ARG 118 314 11 Y 1 A HIS 118 ? A HIS 119 315 11 Y 1 A HIS 119 ? A HIS 120 316 11 Y 1 A HIS 120 ? A HIS 121 317 11 Y 1 A HIS 121 ? A HIS 122 318 11 Y 1 A HIS 122 ? A HIS 123 319 11 Y 1 A HIS 123 ? A HIS 124 320 12 Y 1 A MET 0 ? A MET 1 321 12 Y 1 A GLY 96 ? A GLY 97 322 12 Y 1 A GLN 97 ? A GLN 98 323 12 Y 1 A ALA 98 ? A ALA 99 324 12 Y 1 A GLU 99 ? A GLU 100 325 12 Y 1 A THR 100 ? A THR 101 326 12 Y 1 A GLU 101 ? A GLU 102 327 12 Y 1 A ASP 102 ? A ASP 103 328 12 Y 1 A GLN 103 ? A GLN 104 329 12 Y 1 A VAL 104 ? A VAL 105 330 12 Y 1 A GLY 105 ? A GLY 106 331 12 Y 1 A VAL 106 ? A VAL 107 332 12 Y 1 A VAL 107 ? A VAL 108 333 12 Y 1 A THR 108 ? A THR 109 334 12 Y 1 A GLY 109 ? A GLY 110 335 12 Y 1 A LEU 110 ? A LEU 111 336 12 Y 1 A ALA 111 ? A ALA 112 337 12 Y 1 A TYR 112 ? A TYR 113 338 12 Y 1 A THR 113 ? A THR 114 339 12 Y 1 A THR 114 ? A THR 115 340 12 Y 1 A VAL 115 ? A VAL 116 341 12 Y 1 A LEU 116 ? A LEU 117 342 12 Y 1 A ARG 117 ? A ARG 118 343 12 Y 1 A HIS 118 ? A HIS 119 344 12 Y 1 A HIS 119 ? A HIS 120 345 12 Y 1 A HIS 120 ? A HIS 121 346 12 Y 1 A HIS 121 ? A HIS 122 347 12 Y 1 A HIS 122 ? A HIS 123 348 12 Y 1 A HIS 123 ? A HIS 124 349 13 Y 1 A MET 0 ? A MET 1 350 13 Y 1 A GLY 96 ? A GLY 97 351 13 Y 1 A GLN 97 ? A GLN 98 352 13 Y 1 A ALA 98 ? A ALA 99 353 13 Y 1 A GLU 99 ? A GLU 100 354 13 Y 1 A THR 100 ? A THR 101 355 13 Y 1 A GLU 101 ? A GLU 102 356 13 Y 1 A ASP 102 ? A ASP 103 357 13 Y 1 A GLN 103 ? A GLN 104 358 13 Y 1 A VAL 104 ? A VAL 105 359 13 Y 1 A GLY 105 ? A GLY 106 360 13 Y 1 A VAL 106 ? A VAL 107 361 13 Y 1 A VAL 107 ? A VAL 108 362 13 Y 1 A THR 108 ? A THR 109 363 13 Y 1 A GLY 109 ? A GLY 110 364 13 Y 1 A LEU 110 ? A LEU 111 365 13 Y 1 A ALA 111 ? A ALA 112 366 13 Y 1 A TYR 112 ? A TYR 113 367 13 Y 1 A THR 113 ? A THR 114 368 13 Y 1 A THR 114 ? A THR 115 369 13 Y 1 A VAL 115 ? A VAL 116 370 13 Y 1 A LEU 116 ? A LEU 117 371 13 Y 1 A ARG 117 ? A ARG 118 372 13 Y 1 A HIS 118 ? A HIS 119 373 13 Y 1 A HIS 119 ? A HIS 120 374 13 Y 1 A HIS 120 ? A HIS 121 375 13 Y 1 A HIS 121 ? A HIS 122 376 13 Y 1 A HIS 122 ? A HIS 123 377 13 Y 1 A HIS 123 ? A HIS 124 378 14 Y 1 A MET 0 ? A MET 1 379 14 Y 1 A GLY 96 ? A GLY 97 380 14 Y 1 A GLN 97 ? A GLN 98 381 14 Y 1 A ALA 98 ? A ALA 99 382 14 Y 1 A GLU 99 ? A GLU 100 383 14 Y 1 A THR 100 ? A THR 101 384 14 Y 1 A GLU 101 ? A GLU 102 385 14 Y 1 A ASP 102 ? A ASP 103 386 14 Y 1 A GLN 103 ? A GLN 104 387 14 Y 1 A VAL 104 ? A VAL 105 388 14 Y 1 A GLY 105 ? A GLY 106 389 14 Y 1 A VAL 106 ? A VAL 107 390 14 Y 1 A VAL 107 ? A VAL 108 391 14 Y 1 A THR 108 ? A THR 109 392 14 Y 1 A GLY 109 ? A GLY 110 393 14 Y 1 A LEU 110 ? A LEU 111 394 14 Y 1 A ALA 111 ? A ALA 112 395 14 Y 1 A TYR 112 ? A TYR 113 396 14 Y 1 A THR 113 ? A THR 114 397 14 Y 1 A THR 114 ? A THR 115 398 14 Y 1 A VAL 115 ? A VAL 116 399 14 Y 1 A LEU 116 ? A LEU 117 400 14 Y 1 A ARG 117 ? A ARG 118 401 14 Y 1 A HIS 118 ? A HIS 119 402 14 Y 1 A HIS 119 ? A HIS 120 403 14 Y 1 A HIS 120 ? A HIS 121 404 14 Y 1 A HIS 121 ? A HIS 122 405 14 Y 1 A HIS 122 ? A HIS 123 406 14 Y 1 A HIS 123 ? A HIS 124 407 15 Y 1 A MET 0 ? A MET 1 408 15 Y 1 A GLY 96 ? A GLY 97 409 15 Y 1 A GLN 97 ? A GLN 98 410 15 Y 1 A ALA 98 ? A ALA 99 411 15 Y 1 A GLU 99 ? A GLU 100 412 15 Y 1 A THR 100 ? A THR 101 413 15 Y 1 A GLU 101 ? A GLU 102 414 15 Y 1 A ASP 102 ? A ASP 103 415 15 Y 1 A GLN 103 ? A GLN 104 416 15 Y 1 A VAL 104 ? A VAL 105 417 15 Y 1 A GLY 105 ? A GLY 106 418 15 Y 1 A VAL 106 ? A VAL 107 419 15 Y 1 A VAL 107 ? A VAL 108 420 15 Y 1 A THR 108 ? A THR 109 421 15 Y 1 A GLY 109 ? A GLY 110 422 15 Y 1 A LEU 110 ? A LEU 111 423 15 Y 1 A ALA 111 ? A ALA 112 424 15 Y 1 A TYR 112 ? A TYR 113 425 15 Y 1 A THR 113 ? A THR 114 426 15 Y 1 A THR 114 ? A THR 115 427 15 Y 1 A VAL 115 ? A VAL 116 428 15 Y 1 A LEU 116 ? A LEU 117 429 15 Y 1 A ARG 117 ? A ARG 118 430 15 Y 1 A HIS 118 ? A HIS 119 431 15 Y 1 A HIS 119 ? A HIS 120 432 15 Y 1 A HIS 120 ? A HIS 121 433 15 Y 1 A HIS 121 ? A HIS 122 434 15 Y 1 A HIS 122 ? A HIS 123 435 15 Y 1 A HIS 123 ? A HIS 124 436 16 Y 1 A MET 0 ? A MET 1 437 16 Y 1 A GLY 96 ? A GLY 97 438 16 Y 1 A GLN 97 ? A GLN 98 439 16 Y 1 A ALA 98 ? A ALA 99 440 16 Y 1 A GLU 99 ? A GLU 100 441 16 Y 1 A THR 100 ? A THR 101 442 16 Y 1 A GLU 101 ? A GLU 102 443 16 Y 1 A ASP 102 ? A ASP 103 444 16 Y 1 A GLN 103 ? A GLN 104 445 16 Y 1 A VAL 104 ? A VAL 105 446 16 Y 1 A GLY 105 ? A GLY 106 447 16 Y 1 A VAL 106 ? A VAL 107 448 16 Y 1 A VAL 107 ? A VAL 108 449 16 Y 1 A THR 108 ? A THR 109 450 16 Y 1 A GLY 109 ? A GLY 110 451 16 Y 1 A LEU 110 ? A LEU 111 452 16 Y 1 A ALA 111 ? A ALA 112 453 16 Y 1 A TYR 112 ? A TYR 113 454 16 Y 1 A THR 113 ? A THR 114 455 16 Y 1 A THR 114 ? A THR 115 456 16 Y 1 A VAL 115 ? A VAL 116 457 16 Y 1 A LEU 116 ? A LEU 117 458 16 Y 1 A ARG 117 ? A ARG 118 459 16 Y 1 A HIS 118 ? A HIS 119 460 16 Y 1 A HIS 119 ? A HIS 120 461 16 Y 1 A HIS 120 ? A HIS 121 462 16 Y 1 A HIS 121 ? A HIS 122 463 16 Y 1 A HIS 122 ? A HIS 123 464 16 Y 1 A HIS 123 ? A HIS 124 #