data_1X4S # _entry.id 1X4S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X4S pdb_00001x4s 10.2210/pdb1x4s/pdb RCSB RCSB024378 ? ? WWPDB D_1000024378 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-14 2 'Structure model' 1 1 2007-12-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_ref_seq_dif.details' 19 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X4S _pdbx_database_status.recvd_initial_deposition_date 2005-05-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001004088.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the zinc finger HIT domain in protein FON' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 16 _citation.page_first 1577 _citation.page_last 1587 _citation.year 2007 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17656577 _citation.pdbx_database_id_DOI 10.1110/ps.062635107 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Umehara, T.' 2 ? primary 'Tsuda, K.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Matsuda, T.' 6 ? primary 'Yabuki, T.' 7 ? primary 'Aoki, M.' 8 ? primary 'Seki, E.' 9 ? primary 'Terada, T.' 10 ? primary 'Shirouzu, M.' 11 ? primary 'Tanaka, A.' 12 ? primary 'Sugano, S.' 13 ? primary 'Muto, Y.' 14 ? primary 'Yokoyama, S.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger HIT domain containing protein 2' 6089.731 1 ? ? 'Zinc finger HIT domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein FON' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGMEPAGPCGFCPAGEVQPARYTCPRCNAPYCSLRCYRTHGTCAENFYSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGMEPAGPCGFCPAGEVQPARYTCPRCNAPYCSLRCYRTHGTCAENFYSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001004088.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 GLU n 1 10 PRO n 1 11 ALA n 1 12 GLY n 1 13 PRO n 1 14 CYS n 1 15 GLY n 1 16 PHE n 1 17 CYS n 1 18 PRO n 1 19 ALA n 1 20 GLY n 1 21 GLU n 1 22 VAL n 1 23 GLN n 1 24 PRO n 1 25 ALA n 1 26 ARG n 1 27 TYR n 1 28 THR n 1 29 CYS n 1 30 PRO n 1 31 ARG n 1 32 CYS n 1 33 ASN n 1 34 ALA n 1 35 PRO n 1 36 TYR n 1 37 CYS n 1 38 SER n 1 39 LEU n 1 40 ARG n 1 41 CYS n 1 42 TYR n 1 43 ARG n 1 44 THR n 1 45 HIS n 1 46 GLY n 1 47 THR n 1 48 CYS n 1 49 ALA n 1 50 GLU n 1 51 ASN n 1 52 PHE n 1 53 TYR n 1 54 SER n 1 55 GLY n 1 56 PRO n 1 57 SER n 1 58 SER n 1 59 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ZNHIT2, C11orf5' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040906-13 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLY 59 59 59 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 1X4S _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1X4S _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1X4S _struct.title 'Solution structure of zinc finger HIT domain in protein FON' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X4S _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;Zinc finger HIT domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZNHI2_HUMAN _struct_ref.pdbx_db_accession Q9UHR6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MEPAGPCGFCPAGEVQPARYTCPRCNAPYCSLRCYRTHGTCAENFY _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X4S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UHR6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 46 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 53 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X4S GLY A 1 ? UNP Q9UHR6 ? ? 'expression tag' 1 1 1 1X4S SER A 2 ? UNP Q9UHR6 ? ? 'expression tag' 2 2 1 1X4S SER A 3 ? UNP Q9UHR6 ? ? 'expression tag' 3 3 1 1X4S GLY A 4 ? UNP Q9UHR6 ? ? 'expression tag' 4 4 1 1X4S SER A 5 ? UNP Q9UHR6 ? ? 'expression tag' 5 5 1 1X4S SER A 6 ? UNP Q9UHR6 ? ? 'expression tag' 6 6 1 1X4S GLY A 7 ? UNP Q9UHR6 ? ? 'expression tag' 7 7 1 1X4S SER A 54 ? UNP Q9UHR6 ? ? 'expression tag' 54 8 1 1X4S GLY A 55 ? UNP Q9UHR6 ? ? 'expression tag' 55 9 1 1X4S PRO A 56 ? UNP Q9UHR6 ? ? 'expression tag' 56 10 1 1X4S SER A 57 ? UNP Q9UHR6 ? ? 'expression tag' 57 11 1 1X4S SER A 58 ? UNP Q9UHR6 ? ? 'expression tag' 58 12 1 1X4S GLY A 59 ? UNP Q9UHR6 ? ? 'expression tag' 59 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 39 ? THR A 44 ? LEU A 39 THR A 44 1 ? 6 HELX_P HELX_P2 2 ALA A 49 ? ASN A 51 ? ALA A 49 ASN A 51 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 201 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc2 metalc ? ? A CYS 17 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 17 A ZN 201 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc3 metalc ? ? A CYS 29 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 29 A ZN 401 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc4 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 32 A ZN 401 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc5 metalc ? ? A CYS 37 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 37 A ZN 201 1_555 ? ? ? ? ? ? ? 2.322 ? ? metalc6 metalc ? ? A CYS 41 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc7 metalc ? ? A HIS 45 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 45 A ZN 401 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc8 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 48 A ZN 401 1_555 ? ? ? ? ? ? ? 2.260 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 17 ? A CYS 17 ? 1_555 114.7 ? 2 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 113.7 ? 3 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 106.0 ? 4 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 105.6 ? 5 SG ? A CYS 17 ? A CYS 17 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 105.9 ? 6 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 110.8 ? 7 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 101.7 ? 8 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 105.5 ? 9 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 106.0 ? 10 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 113.0 ? 11 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 112.3 ? 12 NE2 ? A HIS 45 ? A HIS 45 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 116.9 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 12 ? PRO A 13 ? GLY A 12 PRO A 13 A 2 PRO A 24 ? ALA A 25 ? PRO A 24 ALA A 25 B 1 TYR A 27 ? THR A 28 ? TYR A 27 THR A 28 B 2 PRO A 35 ? TYR A 36 ? PRO A 35 TYR A 36 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 2 AC1 4 CYS A 17 ? CYS A 17 . ? 1_555 ? 3 AC1 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 4 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 5 AC2 4 CYS A 29 ? CYS A 29 . ? 1_555 ? 6 AC2 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 7 AC2 4 HIS A 45 ? HIS A 45 . ? 1_555 ? 8 AC2 4 CYS A 48 ? CYS A 48 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -39.27 159.35 2 1 CYS A 14 ? ? -48.62 108.28 3 1 ALA A 19 ? ? -33.33 126.00 4 1 GLU A 21 ? ? -83.17 46.38 5 1 PRO A 24 ? ? -69.73 98.61 6 1 ALA A 25 ? ? -63.01 89.47 7 1 PRO A 30 ? ? -69.74 4.12 8 1 ASN A 33 ? ? 35.75 54.98 9 1 THR A 47 ? ? -98.31 39.10 10 1 ASN A 51 ? ? -97.16 53.62 11 1 PHE A 52 ? ? -134.27 -54.33 12 1 PRO A 56 ? ? -69.76 0.85 13 1 SER A 58 ? ? -37.90 146.88 14 2 CYS A 14 ? ? -42.23 99.08 15 2 PHE A 16 ? ? -133.38 -34.24 16 2 ALA A 19 ? ? -34.03 115.01 17 2 GLU A 21 ? ? -93.65 43.24 18 2 PRO A 30 ? ? -69.80 5.48 19 2 ASN A 33 ? ? 32.67 54.62 20 2 CYS A 48 ? ? -83.30 36.86 21 2 GLU A 50 ? ? -34.11 -39.06 22 3 CYS A 14 ? ? -36.49 104.30 23 3 ALA A 19 ? ? -30.17 134.20 24 3 GLU A 21 ? ? -86.86 40.22 25 3 ALA A 25 ? ? -67.86 87.94 26 3 PRO A 30 ? ? -69.76 6.94 27 3 ASN A 33 ? ? 33.95 54.94 28 3 THR A 47 ? ? -100.33 40.62 29 3 PRO A 56 ? ? -69.79 2.85 30 4 ALA A 11 ? ? -67.37 -177.69 31 4 CYS A 14 ? ? -41.73 97.24 32 4 ALA A 19 ? ? -33.59 125.64 33 4 GLU A 21 ? ? -91.61 41.00 34 4 PRO A 30 ? ? -69.79 7.47 35 4 ASN A 33 ? ? 31.91 54.98 36 4 ALA A 49 ? ? -83.27 35.23 37 4 PHE A 52 ? ? -53.45 104.05 38 5 MET A 8 ? ? -102.36 41.93 39 5 PRO A 10 ? ? -69.82 83.38 40 5 ALA A 11 ? ? -174.79 136.09 41 5 CYS A 14 ? ? -49.76 102.33 42 5 PHE A 16 ? ? -39.70 -37.70 43 5 VAL A 22 ? ? -37.52 120.17 44 5 PRO A 24 ? ? -69.78 91.03 45 5 ALA A 25 ? ? -60.87 94.62 46 5 PRO A 30 ? ? -69.73 5.98 47 5 ASN A 33 ? ? 31.21 55.00 48 5 THR A 47 ? ? -102.85 41.28 49 5 ASN A 51 ? ? -93.62 37.78 50 5 PRO A 56 ? ? -69.76 2.25 51 6 PRO A 10 ? ? -69.75 85.42 52 6 CYS A 14 ? ? -48.31 103.54 53 6 ALA A 19 ? ? -35.89 149.50 54 6 VAL A 22 ? ? -44.98 97.29 55 6 ALA A 25 ? ? -55.18 94.20 56 6 PRO A 30 ? ? -69.74 8.94 57 6 ASN A 51 ? ? -108.72 40.22 58 6 PRO A 56 ? ? -69.78 -175.36 59 7 CYS A 14 ? ? -54.70 99.53 60 7 ALA A 19 ? ? -57.12 102.57 61 7 ALA A 25 ? ? -56.06 93.98 62 7 PRO A 30 ? ? -69.74 2.55 63 7 ASN A 33 ? ? 31.82 54.97 64 7 LEU A 39 ? ? -35.25 -35.71 65 7 ASN A 51 ? ? -92.10 33.99 66 8 ALA A 11 ? ? -171.63 -176.03 67 8 CYS A 14 ? ? -49.35 104.96 68 8 ALA A 19 ? ? -34.58 127.93 69 8 GLU A 21 ? ? -86.36 42.76 70 8 ALA A 25 ? ? -65.64 91.69 71 8 PRO A 30 ? ? -69.75 6.76 72 8 ASN A 33 ? ? 32.66 54.95 73 8 ALA A 49 ? ? -84.26 37.38 74 8 PRO A 56 ? ? -69.74 -179.82 75 8 SER A 57 ? ? -107.94 45.53 76 9 SER A 5 ? ? -81.30 41.99 77 9 PRO A 10 ? ? -69.73 82.00 78 9 CYS A 14 ? ? -56.54 108.45 79 9 ALA A 19 ? ? -34.74 126.08 80 9 GLU A 21 ? ? -85.05 43.93 81 9 PRO A 30 ? ? -69.80 4.56 82 9 ASN A 33 ? ? 33.67 54.94 83 9 PRO A 56 ? ? -69.75 99.75 84 10 GLU A 9 ? ? -45.38 152.16 85 10 CYS A 14 ? ? -42.26 95.92 86 10 ALA A 19 ? ? -34.11 141.92 87 10 VAL A 22 ? ? -33.57 121.87 88 10 ALA A 25 ? ? -66.35 86.57 89 10 PRO A 30 ? ? -69.72 8.23 90 10 ASN A 33 ? ? 36.23 54.91 91 10 SER A 54 ? ? -115.28 77.60 92 11 GLU A 9 ? ? -48.94 150.18 93 11 PRO A 10 ? ? -69.74 88.22 94 11 CYS A 14 ? ? -36.90 104.30 95 11 PHE A 16 ? ? -131.81 -32.80 96 11 ALA A 19 ? ? -34.86 118.15 97 11 GLU A 21 ? ? -89.88 44.00 98 11 PRO A 30 ? ? -69.77 2.22 99 11 ASN A 33 ? ? 33.03 54.46 100 11 GLU A 50 ? ? -36.54 -30.78 101 12 SER A 2 ? ? -170.17 139.08 102 12 ALA A 11 ? ? -57.67 174.30 103 12 CYS A 14 ? ? -36.97 99.45 104 12 ALA A 19 ? ? -33.27 124.84 105 12 GLU A 21 ? ? -85.35 42.81 106 12 ALA A 25 ? ? -67.47 97.16 107 12 PRO A 30 ? ? -69.79 6.49 108 12 THR A 47 ? ? -97.09 39.95 109 13 SER A 5 ? ? -94.21 43.31 110 13 GLU A 9 ? ? -33.50 134.99 111 13 ALA A 19 ? ? -34.35 129.00 112 13 VAL A 22 ? ? -44.84 95.35 113 13 PRO A 24 ? ? -69.77 82.95 114 13 ALA A 25 ? ? -35.19 105.47 115 13 PRO A 30 ? ? -69.85 6.15 116 13 ASN A 33 ? ? 31.83 54.75 117 13 LEU A 39 ? ? -37.36 -35.45 118 13 THR A 47 ? ? -99.14 41.67 119 13 ALA A 49 ? ? -81.48 39.44 120 14 CYS A 14 ? ? -59.63 105.49 121 14 PHE A 16 ? ? -35.84 -31.54 122 14 ALA A 19 ? ? -31.17 134.89 123 14 GLU A 21 ? ? -80.95 45.40 124 14 PRO A 30 ? ? -69.76 7.24 125 14 THR A 47 ? ? -96.53 53.64 126 14 CYS A 48 ? ? -89.92 33.70 127 14 SER A 54 ? ? 37.55 44.80 128 15 PRO A 10 ? ? -69.67 87.56 129 15 CYS A 14 ? ? -64.52 92.43 130 15 ALA A 19 ? ? -28.32 130.71 131 15 GLU A 21 ? ? -88.47 49.86 132 15 PRO A 30 ? ? -69.74 8.21 133 16 SER A 6 ? ? -86.75 39.68 134 16 MET A 8 ? ? -98.55 39.40 135 16 PHE A 16 ? ? -34.53 -38.27 136 16 ALA A 19 ? ? -28.41 132.89 137 16 GLU A 21 ? ? -85.69 43.45 138 16 PRO A 30 ? ? -69.85 5.86 139 16 ASN A 33 ? ? 37.28 55.05 140 16 THR A 47 ? ? -107.40 44.28 141 16 PRO A 56 ? ? -69.76 86.65 142 17 PRO A 10 ? ? -69.80 80.10 143 17 CYS A 14 ? ? -64.48 88.52 144 17 ALA A 19 ? ? -32.45 133.97 145 17 GLU A 21 ? ? -97.35 38.91 146 17 ALA A 25 ? ? -58.76 84.98 147 17 PRO A 30 ? ? -69.79 6.57 148 17 ASN A 33 ? ? 34.90 55.06 149 17 CYS A 48 ? ? -86.25 35.70 150 17 PRO A 56 ? ? -69.74 95.97 151 18 SER A 2 ? ? 35.94 43.49 152 18 CYS A 14 ? ? -59.10 106.97 153 18 PHE A 16 ? ? -39.83 -33.76 154 18 ALA A 19 ? ? -34.81 119.18 155 18 GLU A 21 ? ? -91.99 46.29 156 18 PRO A 30 ? ? -69.75 4.90 157 18 ASN A 33 ? ? 33.57 54.95 158 18 SER A 54 ? ? 34.08 49.80 159 18 PRO A 56 ? ? -69.80 -173.39 160 18 SER A 57 ? ? -84.78 46.10 161 19 SER A 3 ? ? -43.05 159.19 162 19 SER A 5 ? ? 71.14 42.05 163 19 CYS A 14 ? ? -56.89 92.27 164 19 VAL A 22 ? ? -35.80 119.77 165 19 PRO A 24 ? ? -69.77 95.12 166 19 ALA A 25 ? ? -55.65 94.54 167 19 PRO A 30 ? ? -69.81 8.01 168 19 ASN A 33 ? ? 33.71 54.96 169 19 THR A 47 ? ? -93.10 40.47 170 19 PRO A 56 ? ? -69.80 88.54 171 20 GLU A 9 ? ? -39.80 137.45 172 20 ALA A 11 ? ? -54.97 179.66 173 20 CYS A 14 ? ? -41.18 102.77 174 20 PHE A 16 ? ? -130.05 -33.72 175 20 ALA A 19 ? ? -31.53 134.06 176 20 GLU A 21 ? ? -96.10 40.88 177 20 ALA A 25 ? ? -65.15 85.26 178 20 PRO A 30 ? ? -69.74 7.71 179 20 THR A 47 ? ? -103.55 44.81 180 20 ALA A 49 ? ? -86.55 36.78 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX Determination method: author determined ; 700 ;SHEET Determination method: author determined ; # _pdbx_nmr_ensemble.entry_id 1X4S _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X4S _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 100uM ZnCl2; 1mM d-DTT; 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 1X4S _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.863 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 LEU N N N N 142 LEU CA C N S 143 LEU C C N N 144 LEU O O N N 145 LEU CB C N N 146 LEU CG C N N 147 LEU CD1 C N N 148 LEU CD2 C N N 149 LEU OXT O N N 150 LEU H H N N 151 LEU H2 H N N 152 LEU HA H N N 153 LEU HB2 H N N 154 LEU HB3 H N N 155 LEU HG H N N 156 LEU HD11 H N N 157 LEU HD12 H N N 158 LEU HD13 H N N 159 LEU HD21 H N N 160 LEU HD22 H N N 161 LEU HD23 H N N 162 LEU HXT H N N 163 MET N N N N 164 MET CA C N S 165 MET C C N N 166 MET O O N N 167 MET CB C N N 168 MET CG C N N 169 MET SD S N N 170 MET CE C N N 171 MET OXT O N N 172 MET H H N N 173 MET H2 H N N 174 MET HA H N N 175 MET HB2 H N N 176 MET HB3 H N N 177 MET HG2 H N N 178 MET HG3 H N N 179 MET HE1 H N N 180 MET HE2 H N N 181 MET HE3 H N N 182 MET HXT H N N 183 PHE N N N N 184 PHE CA C N S 185 PHE C C N N 186 PHE O O N N 187 PHE CB C N N 188 PHE CG C Y N 189 PHE CD1 C Y N 190 PHE CD2 C Y N 191 PHE CE1 C Y N 192 PHE CE2 C Y N 193 PHE CZ C Y N 194 PHE OXT O N N 195 PHE H H N N 196 PHE H2 H N N 197 PHE HA H N N 198 PHE HB2 H N N 199 PHE HB3 H N N 200 PHE HD1 H N N 201 PHE HD2 H N N 202 PHE HE1 H N N 203 PHE HE2 H N N 204 PHE HZ H N N 205 PHE HXT H N N 206 PRO N N N N 207 PRO CA C N S 208 PRO C C N N 209 PRO O O N N 210 PRO CB C N N 211 PRO CG C N N 212 PRO CD C N N 213 PRO OXT O N N 214 PRO H H N N 215 PRO HA H N N 216 PRO HB2 H N N 217 PRO HB3 H N N 218 PRO HG2 H N N 219 PRO HG3 H N N 220 PRO HD2 H N N 221 PRO HD3 H N N 222 PRO HXT H N N 223 SER N N N N 224 SER CA C N S 225 SER C C N N 226 SER O O N N 227 SER CB C N N 228 SER OG O N N 229 SER OXT O N N 230 SER H H N N 231 SER H2 H N N 232 SER HA H N N 233 SER HB2 H N N 234 SER HB3 H N N 235 SER HG H N N 236 SER HXT H N N 237 THR N N N N 238 THR CA C N S 239 THR C C N N 240 THR O O N N 241 THR CB C N R 242 THR OG1 O N N 243 THR CG2 C N N 244 THR OXT O N N 245 THR H H N N 246 THR H2 H N N 247 THR HA H N N 248 THR HB H N N 249 THR HG1 H N N 250 THR HG21 H N N 251 THR HG22 H N N 252 THR HG23 H N N 253 THR HXT H N N 254 TYR N N N N 255 TYR CA C N S 256 TYR C C N N 257 TYR O O N N 258 TYR CB C N N 259 TYR CG C Y N 260 TYR CD1 C Y N 261 TYR CD2 C Y N 262 TYR CE1 C Y N 263 TYR CE2 C Y N 264 TYR CZ C Y N 265 TYR OH O N N 266 TYR OXT O N N 267 TYR H H N N 268 TYR H2 H N N 269 TYR HA H N N 270 TYR HB2 H N N 271 TYR HB3 H N N 272 TYR HD1 H N N 273 TYR HD2 H N N 274 TYR HE1 H N N 275 TYR HE2 H N N 276 TYR HH H N N 277 TYR HXT H N N 278 VAL N N N N 279 VAL CA C N S 280 VAL C C N N 281 VAL O O N N 282 VAL CB C N N 283 VAL CG1 C N N 284 VAL CG2 C N N 285 VAL OXT O N N 286 VAL H H N N 287 VAL H2 H N N 288 VAL HA H N N 289 VAL HB H N N 290 VAL HG11 H N N 291 VAL HG12 H N N 292 VAL HG13 H N N 293 VAL HG21 H N N 294 VAL HG22 H N N 295 VAL HG23 H N N 296 VAL HXT H N N 297 ZN ZN ZN N N 298 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 LEU N CA sing N N 135 LEU N H sing N N 136 LEU N H2 sing N N 137 LEU CA C sing N N 138 LEU CA CB sing N N 139 LEU CA HA sing N N 140 LEU C O doub N N 141 LEU C OXT sing N N 142 LEU CB CG sing N N 143 LEU CB HB2 sing N N 144 LEU CB HB3 sing N N 145 LEU CG CD1 sing N N 146 LEU CG CD2 sing N N 147 LEU CG HG sing N N 148 LEU CD1 HD11 sing N N 149 LEU CD1 HD12 sing N N 150 LEU CD1 HD13 sing N N 151 LEU CD2 HD21 sing N N 152 LEU CD2 HD22 sing N N 153 LEU CD2 HD23 sing N N 154 LEU OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 PRO N CA sing N N 198 PRO N CD sing N N 199 PRO N H sing N N 200 PRO CA C sing N N 201 PRO CA CB sing N N 202 PRO CA HA sing N N 203 PRO C O doub N N 204 PRO C OXT sing N N 205 PRO CB CG sing N N 206 PRO CB HB2 sing N N 207 PRO CB HB3 sing N N 208 PRO CG CD sing N N 209 PRO CG HG2 sing N N 210 PRO CG HG3 sing N N 211 PRO CD HD2 sing N N 212 PRO CD HD3 sing N N 213 PRO OXT HXT sing N N 214 SER N CA sing N N 215 SER N H sing N N 216 SER N H2 sing N N 217 SER CA C sing N N 218 SER CA CB sing N N 219 SER CA HA sing N N 220 SER C O doub N N 221 SER C OXT sing N N 222 SER CB OG sing N N 223 SER CB HB2 sing N N 224 SER CB HB3 sing N N 225 SER OG HG sing N N 226 SER OXT HXT sing N N 227 THR N CA sing N N 228 THR N H sing N N 229 THR N H2 sing N N 230 THR CA C sing N N 231 THR CA CB sing N N 232 THR CA HA sing N N 233 THR C O doub N N 234 THR C OXT sing N N 235 THR CB OG1 sing N N 236 THR CB CG2 sing N N 237 THR CB HB sing N N 238 THR OG1 HG1 sing N N 239 THR CG2 HG21 sing N N 240 THR CG2 HG22 sing N N 241 THR CG2 HG23 sing N N 242 THR OXT HXT sing N N 243 TYR N CA sing N N 244 TYR N H sing N N 245 TYR N H2 sing N N 246 TYR CA C sing N N 247 TYR CA CB sing N N 248 TYR CA HA sing N N 249 TYR C O doub N N 250 TYR C OXT sing N N 251 TYR CB CG sing N N 252 TYR CB HB2 sing N N 253 TYR CB HB3 sing N N 254 TYR CG CD1 doub Y N 255 TYR CG CD2 sing Y N 256 TYR CD1 CE1 sing Y N 257 TYR CD1 HD1 sing N N 258 TYR CD2 CE2 doub Y N 259 TYR CD2 HD2 sing N N 260 TYR CE1 CZ doub Y N 261 TYR CE1 HE1 sing N N 262 TYR CE2 CZ sing Y N 263 TYR CE2 HE2 sing N N 264 TYR CZ OH sing N N 265 TYR OH HH sing N N 266 TYR OXT HXT sing N N 267 VAL N CA sing N N 268 VAL N H sing N N 269 VAL N H2 sing N N 270 VAL CA C sing N N 271 VAL CA CB sing N N 272 VAL CA HA sing N N 273 VAL C O doub N N 274 VAL C OXT sing N N 275 VAL CB CG1 sing N N 276 VAL CB CG2 sing N N 277 VAL CB HB sing N N 278 VAL CG1 HG11 sing N N 279 VAL CG1 HG12 sing N N 280 VAL CG1 HG13 sing N N 281 VAL CG2 HG21 sing N N 282 VAL CG2 HG22 sing N N 283 VAL CG2 HG23 sing N N 284 VAL OXT HXT sing N N 285 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1X4S _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #