data_1X4V # _entry.id 1X4V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X4V pdb_00001x4v 10.2210/pdb1x4v/pdb RCSB RCSB024381 ? ? WWPDB D_1000024381 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002010558.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X4V _pdbx_database_status.recvd_initial_deposition_date 2005-05-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Kigawa, T.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the zf-AN1 domain from human hypothetical protein LOC130617' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Yokoyama, S.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein LOC130617' 6911.795 1 ? ? 'zf-AN1 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002010558.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 LYS n 1 10 ILE n 1 11 PHE n 1 12 THR n 1 13 ASN n 1 14 LYS n 1 15 CYS n 1 16 GLU n 1 17 ARG n 1 18 ALA n 1 19 GLY n 1 20 CYS n 1 21 ARG n 1 22 GLN n 1 23 ARG n 1 24 GLU n 1 25 MET n 1 26 MET n 1 27 LYS n 1 28 LEU n 1 29 THR n 1 30 CYS n 1 31 GLU n 1 32 ARG n 1 33 CYS n 1 34 SER n 1 35 ARG n 1 36 ASN n 1 37 PHE n 1 38 CYS n 1 39 ILE n 1 40 LYS n 1 41 HIS n 1 42 ARG n 1 43 HIS n 1 44 PRO n 1 45 LEU n 1 46 ASP n 1 47 HIS n 1 48 ASP n 1 49 CYS n 1 50 SER n 1 51 GLY n 1 52 GLU n 1 53 GLY n 1 54 HIS n 1 55 PRO n 1 56 THR n 1 57 SER n 1 58 SER n 1 59 GLY n 1 60 PRO n 1 61 SER n 1 62 SER n 1 63 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene LOC130617 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040921-15 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8WV99_HUMAN _struct_ref.pdbx_db_accession Q8WV99 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTS _struct_ref.pdbx_align_begin 93 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X4V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8WV99 _struct_ref_seq.db_align_beg 93 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 57 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X4V GLY A 1 ? UNP Q8WV99 ? ? 'cloning artifact' 1 1 1 1X4V SER A 2 ? UNP Q8WV99 ? ? 'cloning artifact' 2 2 1 1X4V SER A 3 ? UNP Q8WV99 ? ? 'cloning artifact' 3 3 1 1X4V GLY A 4 ? UNP Q8WV99 ? ? 'cloning artifact' 4 4 1 1X4V SER A 5 ? UNP Q8WV99 ? ? 'cloning artifact' 5 5 1 1X4V SER A 6 ? UNP Q8WV99 ? ? 'cloning artifact' 6 6 1 1X4V GLY A 7 ? UNP Q8WV99 ? ? 'cloning artifact' 7 7 1 1X4V SER A 58 ? UNP Q8WV99 ? ? 'cloning artifact' 58 8 1 1X4V GLY A 59 ? UNP Q8WV99 ? ? 'cloning artifact' 59 9 1 1X4V PRO A 60 ? UNP Q8WV99 ? ? 'cloning artifact' 60 10 1 1X4V SER A 61 ? UNP Q8WV99 ? ? 'cloning artifact' 61 11 1 1X4V SER A 62 ? UNP Q8WV99 ? ? 'cloning artifact' 62 12 1 1X4V GLY A 63 ? UNP Q8WV99 ? ? 'cloning artifact' 63 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.93mM zf-AN1 domain U-15N,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 10uM ZnCl2; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X4V _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X4V _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X4V _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 1X4V _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X4V _struct.title 'Solution structure of the zf-AN1 domain from human hypothetical protein LOC130617' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X4V _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;zf-AN1 domain, zinc binding, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 38 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 43 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 38 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 43 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 15 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 15 A ZN 201 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc2 metalc ? ? A CYS 20 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 20 A ZN 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc3 metalc ? ? A CYS 30 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 30 A ZN 401 1_555 ? ? ? ? ? ? ? 2.370 ? ? metalc4 metalc ? ? A CYS 33 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 33 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc5 metalc ? ? A CYS 38 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 38 A ZN 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc6 metalc ? ? A HIS 41 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.334 ? ? metalc7 metalc ? ? A HIS 47 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 47 A ZN 401 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc8 metalc ? ? A CYS 49 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 49 A ZN 401 1_555 ? ? ? ? ? ? ? 2.356 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 15 ? CYS A 15 . ? 1_555 ? 2 AC1 5 ARG A 17 ? ARG A 17 . ? 1_555 ? 3 AC1 5 CYS A 20 ? CYS A 20 . ? 1_555 ? 4 AC1 5 CYS A 38 ? CYS A 38 . ? 1_555 ? 5 AC1 5 HIS A 41 ? HIS A 41 . ? 1_555 ? 6 AC2 4 CYS A 30 ? CYS A 30 . ? 1_555 ? 7 AC2 4 CYS A 33 ? CYS A 33 . ? 1_555 ? 8 AC2 4 HIS A 47 ? HIS A 47 . ? 1_555 ? 9 AC2 4 CYS A 49 ? CYS A 49 . ? 1_555 ? # _database_PDB_matrix.entry_id 1X4V _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X4V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLY 63 63 63 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 20 ? A CYS 20 ? 1_555 117.2 ? 2 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 116.7 ? 3 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 117.6 ? 4 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 115.1 ? 5 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 90.1 ? 6 SG ? A CYS 38 ? A CYS 38 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 41 ? A HIS 41 ? 1_555 93.9 ? 7 SG ? A CYS 30 ? A CYS 30 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 33 ? A CYS 33 ? 1_555 96.9 ? 8 SG ? A CYS 30 ? A CYS 30 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 47 ? A HIS 47 ? 1_555 110.5 ? 9 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 47 ? A HIS 47 ? 1_555 117.6 ? 10 SG ? A CYS 30 ? A CYS 30 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 113.9 ? 11 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 116.9 ? 12 NE2 ? A HIS 47 ? A HIS 47 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 101.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-15 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2022-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 21 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 39 ? ? -35.61 -39.46 2 1 PRO A 44 ? ? -69.76 3.54 3 1 ASP A 48 ? ? -59.02 86.78 4 2 SER A 5 ? ? -59.73 108.87 5 2 ARG A 8 ? ? -34.67 107.04 6 2 CYS A 30 ? ? -58.21 171.06 7 2 ILE A 39 ? ? -37.25 -39.28 8 2 PRO A 44 ? ? -69.71 5.49 9 2 ASP A 48 ? ? -57.61 81.48 10 2 GLU A 52 ? ? 33.87 38.09 11 2 PRO A 60 ? ? -69.79 8.34 12 3 PRO A 44 ? ? -69.74 4.52 13 3 ASP A 48 ? ? -53.06 96.22 14 3 SER A 50 ? ? -108.48 -66.28 15 3 GLU A 52 ? ? -50.34 103.00 16 4 ILE A 10 ? ? -90.18 58.67 17 4 ARG A 21 ? ? -100.86 41.53 18 4 ILE A 39 ? ? -36.87 -38.05 19 4 PRO A 44 ? ? -69.77 4.79 20 4 ASP A 48 ? ? -55.29 87.30 21 4 THR A 56 ? ? -38.20 114.19 22 4 SER A 57 ? ? -87.80 41.43 23 4 SER A 62 ? ? 35.52 46.89 24 5 ILE A 39 ? ? -36.93 -37.15 25 5 PRO A 44 ? ? -69.75 4.12 26 5 ASP A 48 ? ? -54.91 89.31 27 5 PRO A 55 ? ? -69.74 98.19 28 5 THR A 56 ? ? -44.89 167.03 29 5 PRO A 60 ? ? -69.73 84.70 30 5 SER A 62 ? ? -83.02 46.92 31 6 GLU A 16 ? ? -91.00 30.64 32 6 ARG A 21 ? ? -108.99 40.82 33 6 ILE A 39 ? ? -38.32 -38.73 34 6 PRO A 44 ? ? -69.79 7.91 35 6 ASP A 48 ? ? -57.31 84.55 36 6 SER A 58 ? ? -89.17 42.85 37 7 SER A 3 ? ? -44.93 162.92 38 7 THR A 12 ? ? -67.16 89.52 39 7 ASP A 48 ? ? 38.78 46.61 40 7 CYS A 49 ? ? -42.28 151.81 41 8 ILE A 10 ? ? -96.17 39.76 42 8 CYS A 30 ? ? -56.65 171.25 43 8 ILE A 39 ? ? -37.02 -38.40 44 8 PRO A 44 ? ? -69.77 4.34 45 8 ASP A 48 ? ? -52.62 100.36 46 8 SER A 58 ? ? 37.06 42.15 47 9 SER A 3 ? ? -100.15 42.27 48 9 ILE A 10 ? ? -79.11 43.37 49 9 PRO A 44 ? ? -69.72 5.88 50 9 ASP A 48 ? ? -56.13 87.93 51 10 ILE A 10 ? ? -101.93 40.11 52 10 PHE A 11 ? ? -83.40 37.02 53 10 GLU A 24 ? ? -39.23 120.41 54 10 ASP A 48 ? ? -44.92 99.57 55 10 GLU A 52 ? ? -93.05 -62.22 56 10 SER A 57 ? ? -108.53 42.36 57 10 SER A 62 ? ? -130.59 -55.74 58 11 ILE A 10 ? ? -85.61 38.68 59 11 ILE A 39 ? ? -36.88 -39.57 60 11 PRO A 44 ? ? -69.77 10.24 61 11 HIS A 47 ? ? -98.11 33.58 62 11 ASP A 48 ? ? 34.81 52.54 63 11 CYS A 49 ? ? -32.81 135.02 64 11 GLU A 52 ? ? 32.80 45.84 65 12 PRO A 44 ? ? -69.74 6.89 66 12 ASP A 48 ? ? -53.38 104.30 67 12 HIS A 54 ? ? -45.13 153.53 68 12 SER A 62 ? ? -101.65 42.22 69 13 SER A 2 ? ? -172.37 118.59 70 13 SER A 6 ? ? -166.99 119.67 71 13 THR A 12 ? ? -61.06 98.63 72 13 ALA A 18 ? ? -33.72 132.00 73 13 PRO A 44 ? ? -69.79 2.94 74 13 ASP A 48 ? ? 36.47 45.13 75 13 CYS A 49 ? ? -35.45 150.00 76 13 HIS A 54 ? ? -36.19 146.11 77 14 PRO A 44 ? ? -69.80 4.99 78 14 ASP A 48 ? ? -54.59 87.82 79 14 THR A 56 ? ? 36.19 40.09 80 14 SER A 61 ? ? 35.72 42.19 81 14 SER A 62 ? ? -43.10 99.83 82 15 ILE A 10 ? ? -80.55 44.86 83 15 CYS A 15 ? ? -49.56 155.79 84 15 CYS A 20 ? ? -135.00 -62.80 85 15 CYS A 30 ? ? -59.68 172.06 86 15 ILE A 39 ? ? -36.21 -36.67 87 15 PRO A 44 ? ? -69.72 6.76 88 15 ASP A 48 ? ? -54.75 91.56 89 16 ARG A 8 ? ? 31.62 48.48 90 16 ASN A 13 ? ? -42.64 165.60 91 16 CYS A 30 ? ? -52.87 170.61 92 16 ILE A 39 ? ? -37.53 -38.08 93 16 PRO A 44 ? ? -69.80 3.17 94 16 ASP A 48 ? ? -57.41 91.47 95 17 CYS A 20 ? ? -130.46 -70.50 96 17 ILE A 39 ? ? -38.34 -38.82 97 17 PRO A 44 ? ? -69.79 7.72 98 17 SER A 58 ? ? -43.97 101.89 99 17 PRO A 60 ? ? -69.71 95.08 100 18 ALA A 18 ? ? -33.73 136.87 101 18 PRO A 44 ? ? -69.76 3.83 102 18 ASP A 48 ? ? -43.78 98.01 103 18 PRO A 55 ? ? -69.77 2.06 104 19 ILE A 10 ? ? -40.00 -26.50 105 19 GLU A 16 ? ? -96.02 31.75 106 19 CYS A 30 ? ? -57.66 170.30 107 19 ILE A 39 ? ? -39.29 -39.13 108 19 PRO A 44 ? ? -69.77 11.36 109 19 ASP A 48 ? ? -57.53 90.80 110 20 SER A 2 ? ? 35.47 42.19 111 20 CYS A 20 ? ? -134.60 -53.20 112 20 ARG A 21 ? ? 31.65 37.33 113 20 ILE A 39 ? ? -37.01 -35.73 114 20 PRO A 44 ? ? -69.77 6.53 115 20 ASP A 48 ? ? -47.96 92.05 116 20 PRO A 60 ? ? -69.77 4.32 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #