data_1X4W # _entry.id 1X4W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X4W pdb_00001x4w 10.2210/pdb1x4w/pdb RCSB RCSB024382 ? ? WWPDB D_1000024382 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002022137.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X4W _pdbx_database_status.recvd_initial_deposition_date 2005-05-15 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomizawa, T.' 1 'Kigawa, T.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the zf-AN1 domain from human hypothetical protein FLJ13222' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomizawa, T.' 1 ? primary 'Kigawa, T.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Yokoyama, S.' 5 ? # _cell.entry_id 1X4W _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1X4W _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein FLJ13222' 7424.394 1 ? ? 'zf-AN1 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002022137.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 ARG n 1 10 SER n 1 11 LYS n 1 12 GLN n 1 13 LYS n 1 14 SER n 1 15 ARG n 1 16 ARG n 1 17 ARG n 1 18 CYS n 1 19 PHE n 1 20 GLN n 1 21 CYS n 1 22 GLN n 1 23 THR n 1 24 LYS n 1 25 LEU n 1 26 GLU n 1 27 LEU n 1 28 VAL n 1 29 GLN n 1 30 GLN n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 SER n 1 35 CYS n 1 36 ARG n 1 37 CYS n 1 38 GLY n 1 39 TYR n 1 40 VAL n 1 41 PHE n 1 42 CYS n 1 43 MET n 1 44 LEU n 1 45 HIS n 1 46 ARG n 1 47 LEU n 1 48 PRO n 1 49 GLU n 1 50 GLN n 1 51 HIS n 1 52 ASP n 1 53 CYS n 1 54 THR n 1 55 PHE n 1 56 ASP n 1 57 HIS n 1 58 MET n 1 59 GLY n 1 60 ARG n 1 61 GLY n 1 62 SER n 1 63 GLY n 1 64 PRO n 1 65 SER n 1 66 SER n 1 67 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene TEX27 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041206-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZFAN3_HUMAN _struct_ref.pdbx_db_accession Q9H8U3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SRSKQKSRRRCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRG _struct_ref.pdbx_align_begin 147 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X4W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H8U3 _struct_ref_seq.db_align_beg 147 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 61 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X4W GLY A 1 ? UNP Q9H8U3 ? ? 'cloning artifact' 1 1 1 1X4W SER A 2 ? UNP Q9H8U3 ? ? 'cloning artifact' 2 2 1 1X4W SER A 3 ? UNP Q9H8U3 ? ? 'cloning artifact' 3 3 1 1X4W GLY A 4 ? UNP Q9H8U3 ? ? 'cloning artifact' 4 4 1 1X4W SER A 5 ? UNP Q9H8U3 ? ? 'cloning artifact' 5 5 1 1X4W SER A 6 ? UNP Q9H8U3 ? ? 'cloning artifact' 6 6 1 1X4W GLY A 7 ? UNP Q9H8U3 ? ? 'cloning artifact' 7 7 1 1X4W SER A 62 ? UNP Q9H8U3 ? ? 'cloning artifact' 62 8 1 1X4W GLY A 63 ? UNP Q9H8U3 ? ? 'cloning artifact' 63 9 1 1X4W PRO A 64 ? UNP Q9H8U3 ? ? 'cloning artifact' 64 10 1 1X4W SER A 65 ? UNP Q9H8U3 ? ? 'cloning artifact' 65 11 1 1X4W SER A 66 ? UNP Q9H8U3 ? ? 'cloning artifact' 66 12 1 1X4W GLY A 67 ? UNP Q9H8U3 ? ? 'cloning artifact' 67 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.66mM zf-AN1 domain U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.05mM EDTA-2Zn; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X4W _pdbx_nmr_refine.method 'torsion angle dynamics, restrainted molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X4W _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X4W _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 1X4W _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X4W _struct.title 'Solution structure of the zf-AN1 domain from human hypothetical protein FLJ13222' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X4W _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;zf-AN1 domain, zinc binding, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 26 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 34 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 26 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 34 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc3 metalc ? ? A CYS 35 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 35 A ZN 401 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc4 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 401 1_555 ? ? ? ? ? ? ? 2.361 ? ? metalc5 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc6 metalc ? ? A HIS 45 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 45 A ZN 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc7 metalc ? ? A HIS 51 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 51 A ZN 401 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc8 metalc ? ? A CYS 53 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 53 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 4 AC1 4 HIS A 45 ? HIS A 45 . ? 1_555 ? 5 AC2 4 CYS A 35 ? CYS A 35 . ? 1_555 ? 6 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 7 AC2 4 HIS A 51 ? HIS A 51 . ? 1_555 ? 8 AC2 4 CYS A 53 ? CYS A 53 . ? 1_555 ? # _database_PDB_matrix.entry_id 1X4W _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X4W _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 97.6 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 118.4 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 102.3 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 116.2 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 118.5 ? 6 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 45 ? A HIS 45 ? 1_555 103.8 ? 7 SG ? A CYS 35 ? A CYS 35 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 110.2 ? 8 SG ? A CYS 35 ? A CYS 35 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 102.5 ? 9 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 116.5 ? 10 SG ? A CYS 35 ? A CYS 35 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 116.7 ? 11 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 111.6 ? 12 NE2 ? A HIS 51 ? A HIS 51 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 98.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-15 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_dist_value' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 18 4 'Structure model' '_struct_ref_seq_dif.details' 19 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -64.98 85.31 2 1 CYS A 18 ? ? -45.36 165.11 3 1 GLN A 30 ? ? -35.15 -35.68 4 1 SER A 34 ? ? -34.22 150.38 5 1 ASP A 52 ? ? 33.65 46.17 6 1 CYS A 53 ? ? -36.50 139.26 7 2 GLN A 30 ? ? -33.51 -38.00 8 2 SER A 34 ? ? -35.29 152.11 9 2 ASP A 52 ? ? 35.74 42.01 10 2 CYS A 53 ? ? -35.63 141.14 11 2 PHE A 55 ? ? -54.59 171.88 12 2 MET A 58 ? ? -67.47 84.06 13 2 PRO A 64 ? ? -69.77 4.22 14 3 SER A 2 ? ? -63.17 85.24 15 3 SER A 3 ? ? -57.96 106.10 16 3 SER A 6 ? ? -170.53 136.14 17 3 GLN A 12 ? ? -56.03 109.63 18 3 GLN A 22 ? ? 39.46 46.05 19 3 GLN A 30 ? ? -33.26 -37.99 20 3 SER A 34 ? ? -39.26 148.94 21 3 ASP A 52 ? ? 34.43 44.59 22 3 CYS A 53 ? ? -34.35 143.85 23 3 PHE A 55 ? ? -59.73 172.81 24 4 ARG A 9 ? ? -90.82 53.53 25 4 CYS A 18 ? ? -42.69 166.11 26 4 GLU A 26 ? ? -49.68 150.72 27 4 GLN A 30 ? ? -35.10 -32.33 28 4 SER A 34 ? ? -35.66 151.55 29 4 ASP A 52 ? ? 35.85 46.51 30 4 CYS A 53 ? ? -37.74 143.33 31 4 PRO A 64 ? ? -69.77 5.11 32 4 SER A 65 ? ? 74.63 39.26 33 5 SER A 8 ? ? -44.43 104.55 34 5 CYS A 18 ? ? -46.29 166.03 35 5 GLN A 30 ? ? -34.28 -34.69 36 5 SER A 34 ? ? -41.06 154.45 37 5 ASP A 52 ? ? 34.66 46.91 38 5 CYS A 53 ? ? -37.87 138.87 39 5 SER A 66 ? ? -131.01 -44.76 40 6 ARG A 9 ? ? -93.51 48.69 41 6 GLN A 12 ? ? -67.37 83.43 42 6 ARG A 15 ? ? -39.48 -37.42 43 6 GLN A 30 ? ? -33.71 -35.57 44 6 SER A 34 ? ? -34.85 151.23 45 6 ASP A 52 ? ? 34.15 45.60 46 6 CYS A 53 ? ? -36.01 142.04 47 6 HIS A 57 ? ? -91.57 41.09 48 6 ARG A 60 ? ? -165.44 106.76 49 6 SER A 65 ? ? -107.07 42.29 50 7 SER A 6 ? ? -122.18 -58.62 51 7 GLN A 12 ? ? -52.52 97.82 52 7 SER A 14 ? ? -168.52 112.45 53 7 GLN A 30 ? ? -33.27 -35.43 54 7 SER A 34 ? ? -36.40 153.30 55 7 ASP A 52 ? ? 34.19 45.86 56 7 CYS A 53 ? ? -36.34 143.45 57 7 PHE A 55 ? ? -59.02 179.54 58 8 SER A 3 ? ? -84.05 42.20 59 8 ARG A 9 ? ? -128.95 -52.06 60 8 ARG A 16 ? ? -39.12 -37.04 61 8 GLN A 30 ? ? -33.90 -39.75 62 8 SER A 34 ? ? -34.19 150.31 63 8 ASP A 52 ? ? 32.95 45.54 64 8 CYS A 53 ? ? -36.77 140.81 65 9 CYS A 18 ? ? -47.54 165.38 66 9 GLN A 30 ? ? -34.47 -37.41 67 9 SER A 34 ? ? -36.23 148.61 68 9 ASP A 52 ? ? 34.04 45.40 69 9 CYS A 53 ? ? -37.00 141.18 70 9 PRO A 64 ? ? -69.81 93.95 71 10 SER A 5 ? ? -64.08 98.29 72 10 ARG A 9 ? ? 72.76 41.42 73 10 CYS A 18 ? ? -48.60 165.88 74 10 GLN A 30 ? ? -33.36 -37.19 75 10 SER A 34 ? ? -35.16 152.12 76 10 CYS A 42 ? ? -54.99 -176.42 77 10 ASP A 52 ? ? 34.25 44.95 78 10 CYS A 53 ? ? -36.38 141.67 79 11 ARG A 9 ? ? -89.39 41.72 80 11 ARG A 15 ? ? -81.85 42.12 81 11 CYS A 18 ? ? -41.59 164.16 82 11 SER A 34 ? ? -36.64 151.40 83 11 ASP A 52 ? ? 34.71 43.06 84 11 CYS A 53 ? ? -34.54 143.33 85 11 PHE A 55 ? ? -58.88 174.83 86 11 HIS A 57 ? ? -59.28 92.49 87 11 ARG A 60 ? ? -173.83 149.52 88 12 SER A 6 ? ? -39.04 145.62 89 12 SER A 8 ? ? -34.82 -39.74 90 12 GLN A 12 ? ? 74.58 45.67 91 12 CYS A 18 ? ? -48.18 165.83 92 12 GLN A 30 ? ? -31.10 -38.46 93 12 SER A 34 ? ? -38.91 151.33 94 12 ASP A 52 ? ? 34.67 47.14 95 12 CYS A 53 ? ? -37.79 140.33 96 12 SER A 65 ? ? -105.46 42.51 97 13 ARG A 15 ? ? -89.14 46.52 98 13 CYS A 18 ? ? -43.89 164.92 99 13 GLN A 22 ? ? 38.13 50.39 100 13 GLN A 30 ? ? -34.22 -33.89 101 13 SER A 34 ? ? -34.74 151.00 102 13 ASP A 52 ? ? 33.82 46.19 103 13 CYS A 53 ? ? -36.90 142.30 104 13 ASP A 56 ? ? -81.82 49.01 105 13 PRO A 64 ? ? -69.79 5.67 106 13 SER A 65 ? ? -32.21 113.42 107 14 SER A 6 ? ? -95.84 -61.12 108 14 LYS A 13 ? ? -38.82 -38.04 109 14 SER A 14 ? ? -160.88 110.09 110 14 CYS A 18 ? ? -48.10 163.98 111 14 LEU A 27 ? ? -35.43 -38.33 112 14 SER A 34 ? ? -37.57 154.87 113 14 ASP A 52 ? ? 34.71 47.78 114 14 CYS A 53 ? ? -39.37 141.11 115 14 MET A 58 ? ? -44.30 108.81 116 15 CYS A 18 ? ? -41.70 164.81 117 15 GLN A 30 ? ? -32.44 -38.73 118 15 SER A 34 ? ? -37.13 150.79 119 15 ASP A 52 ? ? 33.41 46.70 120 15 CYS A 53 ? ? -37.57 141.21 121 15 SER A 62 ? ? -174.06 132.37 122 16 SER A 6 ? ? -108.86 43.02 123 16 ARG A 15 ? ? -79.11 45.99 124 16 CYS A 18 ? ? -46.85 164.26 125 16 GLN A 30 ? ? -32.74 -36.70 126 16 SER A 34 ? ? -33.80 145.17 127 16 ASP A 52 ? ? 34.13 45.93 128 16 CYS A 53 ? ? -35.77 141.32 129 16 PHE A 55 ? ? -49.90 167.49 130 16 PRO A 64 ? ? -69.78 87.87 131 17 ARG A 16 ? ? -32.80 -35.55 132 17 CYS A 18 ? ? -44.10 165.92 133 17 GLN A 30 ? ? -33.93 -34.85 134 17 SER A 34 ? ? -36.61 151.82 135 17 ASP A 52 ? ? 33.53 45.86 136 17 CYS A 53 ? ? -35.93 136.94 137 17 ARG A 60 ? ? -56.08 103.56 138 17 PRO A 64 ? ? -69.72 88.65 139 18 ARG A 15 ? ? -84.46 39.33 140 18 CYS A 18 ? ? -42.68 166.18 141 18 GLN A 30 ? ? -33.39 -34.62 142 18 SER A 34 ? ? -37.27 149.14 143 18 ASP A 52 ? ? 33.55 45.32 144 18 CYS A 53 ? ? -36.43 141.00 145 19 GLN A 12 ? ? 74.00 43.40 146 19 ARG A 15 ? ? -83.09 39.26 147 19 CYS A 18 ? ? -42.82 166.38 148 19 GLN A 30 ? ? -34.60 -32.73 149 19 SER A 34 ? ? -42.27 151.69 150 19 ASP A 52 ? ? 34.45 46.78 151 19 CYS A 53 ? ? -38.22 140.62 152 19 PHE A 55 ? ? -58.94 173.08 153 19 ARG A 60 ? ? 35.11 45.62 154 19 PRO A 64 ? ? -69.77 0.01 155 20 LYS A 11 ? ? -99.93 -65.19 156 20 GLN A 30 ? ? -31.74 -37.10 157 20 SER A 34 ? ? -38.00 156.01 158 20 CYS A 42 ? ? -54.50 -176.84 159 20 ARG A 46 ? ? -39.66 -36.80 160 20 ASP A 52 ? ? 34.39 43.71 161 20 CYS A 53 ? ? -34.39 142.86 162 20 PHE A 55 ? ? -48.66 154.01 163 20 MET A 58 ? ? -41.28 157.73 164 20 PRO A 64 ? ? -69.77 90.33 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #