data_1X5P # _entry.id 1X5P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X5P pdb_00001x5p 10.2210/pdb1x5p/pdb RCSB RCSB024411 ? ? WWPDB D_1000024411 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002013680.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X5P _pdbx_database_status.recvd_initial_deposition_date 2005-05-16 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dang, W.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of RRM domain in Parp14' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dang, W.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _cell.entry_id 1X5P _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1X5P _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Negative elongation factor E' _entity.formula_weight 10407.619 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RRM domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NELF-E, RD protein, Parp14' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLK VNIARKQPMLDSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLK VNIARKQPMLDSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002013680.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 ARG n 1 10 ARG n 1 11 ALA n 1 12 PRO n 1 13 ARG n 1 14 LYS n 1 15 GLY n 1 16 ASN n 1 17 THR n 1 18 LEU n 1 19 TYR n 1 20 VAL n 1 21 TYR n 1 22 GLY n 1 23 GLU n 1 24 ASP n 1 25 MET n 1 26 THR n 1 27 PRO n 1 28 THR n 1 29 LEU n 1 30 LEU n 1 31 ARG n 1 32 GLY n 1 33 ALA n 1 34 PHE n 1 35 SER n 1 36 PRO n 1 37 PHE n 1 38 GLY n 1 39 ASN n 1 40 ILE n 1 41 ILE n 1 42 ASP n 1 43 LEU n 1 44 SER n 1 45 MET n 1 46 ASP n 1 47 PRO n 1 48 PRO n 1 49 ARG n 1 50 ASN n 1 51 CYS n 1 52 ALA n 1 53 PHE n 1 54 VAL n 1 55 THR n 1 56 TYR n 1 57 GLU n 1 58 LYS n 1 59 MET n 1 60 GLU n 1 61 SER n 1 62 ALA n 1 63 ASP n 1 64 GLN n 1 65 ALA n 1 66 VAL n 1 67 ALA n 1 68 GLU n 1 69 LEU n 1 70 ASN n 1 71 GLY n 1 72 THR n 1 73 GLN n 1 74 VAL n 1 75 GLU n 1 76 SER n 1 77 VAL n 1 78 GLN n 1 79 LEU n 1 80 LYS n 1 81 VAL n 1 82 ASN n 1 83 ILE n 1 84 ALA n 1 85 ARG n 1 86 LYS n 1 87 GLN n 1 88 PRO n 1 89 MET n 1 90 LEU n 1 91 ASP n 1 92 SER n 1 93 GLY n 1 94 PRO n 1 95 SER n 1 96 SER n 1 97 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'RDBP, NELFE, RD' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041108-01 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NELFE_HUMAN _struct_ref.pdbx_db_accession P18615 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQ PMLD ; _struct_ref.pdbx_align_begin 54 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X5P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18615 _struct_ref_seq.db_align_beg 54 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 137 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X5P GLY A 1 ? UNP P18615 ? ? 'cloning artifact' 1 1 1 1X5P SER A 2 ? UNP P18615 ? ? 'cloning artifact' 2 2 1 1X5P SER A 3 ? UNP P18615 ? ? 'cloning artifact' 3 3 1 1X5P GLY A 4 ? UNP P18615 ? ? 'cloning artifact' 4 4 1 1X5P SER A 5 ? UNP P18615 ? ? 'cloning artifact' 5 5 1 1X5P SER A 6 ? UNP P18615 ? ? 'cloning artifact' 6 6 1 1X5P GLY A 7 ? UNP P18615 ? ? 'cloning artifact' 7 7 1 1X5P SER A 92 ? UNP P18615 ? ? 'cloning artifact' 92 8 1 1X5P GLY A 93 ? UNP P18615 ? ? 'cloning artifact' 93 9 1 1X5P PRO A 94 ? UNP P18615 ? ? 'cloning artifact' 94 10 1 1X5P SER A 95 ? UNP P18615 ? ? 'cloning artifact' 95 11 1 1X5P SER A 96 ? UNP P18615 ? ? 'cloning artifact' 96 12 1 1X5P GLY A 97 ? UNP P18615 ? ? 'cloning artifact' 97 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15, 13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90%H2O, 10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X5P _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X5P _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X5P _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.925 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 1X5P _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X5P _struct.title 'Solution structure of RRM domain in Parp14' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X5P _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;structure genomics, RRM domain, Parp14, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 27 ? PHE A 34 ? PRO A 27 PHE A 34 1 ? 8 HELX_P HELX_P2 2 MET A 59 ? GLU A 68 ? MET A 59 GLU A 68 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 40 ? ASP A 46 ? ILE A 40 ASP A 46 A 2 CYS A 51 ? TYR A 56 ? CYS A 51 TYR A 56 A 3 THR A 17 ? TYR A 21 ? THR A 17 TYR A 21 A 4 VAL A 77 ? ASN A 82 ? VAL A 77 ASN A 82 A 5 THR A 72 ? VAL A 74 ? THR A 72 VAL A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 46 ? N ASP A 46 O CYS A 51 ? O CYS A 51 A 2 3 O ALA A 52 ? O ALA A 52 N VAL A 20 ? N VAL A 20 A 3 4 N TYR A 19 ? N TYR A 19 O ASN A 82 ? O ASN A 82 A 4 5 O LEU A 79 ? O LEU A 79 N THR A 72 ? N THR A 72 # _database_PDB_matrix.entry_id 1X5P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X5P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-16 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 12 ? ? -69.74 -177.90 2 1 LYS A 14 ? ? -171.47 141.52 3 1 GLU A 23 ? ? -131.02 -49.33 4 1 ALA A 84 ? ? -37.82 140.22 5 1 LYS A 86 ? ? 73.18 46.50 6 1 GLN A 87 ? ? -116.61 78.91 7 1 SER A 96 ? ? -83.69 39.80 8 2 SER A 3 ? ? -101.26 43.06 9 2 PRO A 12 ? ? -69.78 0.49 10 2 GLU A 23 ? ? -132.81 -45.37 11 2 MET A 89 ? ? -46.60 101.49 12 3 SER A 2 ? ? -36.15 117.37 13 3 ARG A 13 ? ? -44.69 166.14 14 3 GLU A 23 ? ? -125.20 -51.59 15 3 PRO A 36 ? ? -48.02 -19.80 16 3 ASN A 70 ? ? -39.74 116.73 17 3 PRO A 88 ? ? -69.77 -178.54 18 3 MET A 89 ? ? -62.74 99.32 19 4 GLU A 23 ? ? -117.98 -70.50 20 4 ASP A 24 ? ? -101.86 53.23 21 4 ILE A 83 ? ? -69.35 95.14 22 4 ALA A 84 ? ? -39.73 101.62 23 4 GLN A 87 ? ? -116.39 78.88 24 4 PRO A 88 ? ? -69.77 -177.22 25 4 MET A 89 ? ? -37.77 100.68 26 4 SER A 95 ? ? -45.76 100.12 27 5 ASP A 24 ? ? -107.51 51.12 28 5 ASN A 50 ? ? 36.29 41.54 29 5 ASN A 70 ? ? -37.38 116.54 30 5 ILE A 83 ? ? -65.80 97.83 31 5 ALA A 84 ? ? -38.63 158.47 32 5 LYS A 86 ? ? -93.49 47.74 33 5 GLN A 87 ? ? -113.36 79.05 34 5 MET A 89 ? ? -48.22 107.35 35 5 PRO A 94 ? ? -69.75 98.84 36 6 ARG A 10 ? ? -49.98 173.22 37 6 ARG A 13 ? ? -116.19 75.85 38 6 ASN A 50 ? ? 38.98 36.82 39 6 ILE A 83 ? ? -69.82 96.17 40 6 ARG A 85 ? ? -89.28 33.65 41 6 PRO A 88 ? ? -69.76 -175.15 42 6 LEU A 90 ? ? -113.64 77.46 43 6 SER A 95 ? ? -54.00 177.84 44 7 GLU A 23 ? ? -133.47 -39.88 45 7 ASN A 50 ? ? 38.65 30.65 46 7 PRO A 88 ? ? -69.72 -176.11 47 7 SER A 92 ? ? -39.58 109.63 48 7 SER A 96 ? ? -171.29 149.02 49 8 SER A 6 ? ? -169.60 115.75 50 8 PRO A 12 ? ? -69.78 95.94 51 8 GLU A 23 ? ? -131.57 -42.25 52 8 ILE A 83 ? ? -68.92 95.30 53 8 ALA A 84 ? ? -37.12 106.68 54 8 PRO A 88 ? ? -69.78 -179.67 55 9 SER A 5 ? ? -171.64 134.34 56 9 ALA A 11 ? ? -175.03 144.79 57 9 PRO A 12 ? ? -69.77 2.90 58 9 ARG A 13 ? ? 31.29 43.43 59 9 ARG A 85 ? ? -36.62 153.71 60 9 LYS A 86 ? ? -36.03 140.50 61 9 PRO A 88 ? ? -69.76 -179.10 62 9 LEU A 90 ? ? -35.95 127.76 63 10 GLU A 8 ? ? -69.59 95.58 64 10 ARG A 10 ? ? -38.79 121.64 65 10 GLU A 23 ? ? -132.23 -56.40 66 10 PRO A 36 ? ? -47.90 -19.16 67 10 LYS A 86 ? ? -105.36 41.40 68 10 PRO A 88 ? ? -69.68 -171.56 69 10 LEU A 90 ? ? -89.31 42.75 70 10 PRO A 94 ? ? -69.73 89.54 71 11 ARG A 9 ? ? 34.34 43.72 72 11 PRO A 12 ? ? -69.77 99.61 73 11 GLU A 23 ? ? -117.36 -70.32 74 11 ASP A 24 ? ? -103.50 52.68 75 11 ASN A 50 ? ? 36.54 37.48 76 11 ILE A 83 ? ? -67.95 97.14 77 11 ALA A 84 ? ? -50.57 105.13 78 11 SER A 95 ? ? -82.87 40.12 79 11 SER A 96 ? ? 38.22 41.71 80 12 SER A 2 ? ? -47.69 172.57 81 12 PRO A 12 ? ? -69.84 -173.18 82 12 ASP A 24 ? ? -109.96 50.60 83 12 GLN A 87 ? ? -119.65 71.26 84 12 PRO A 88 ? ? -69.75 -174.68 85 12 MET A 89 ? ? 37.36 28.58 86 12 SER A 96 ? ? -42.96 158.18 87 13 SER A 5 ? ? 37.38 45.42 88 13 GLU A 23 ? ? -131.07 -61.68 89 13 ILE A 83 ? ? -65.86 98.04 90 13 ALA A 84 ? ? -39.73 142.98 91 13 MET A 89 ? ? -43.53 102.72 92 14 GLU A 23 ? ? -131.61 -34.56 93 14 ALA A 84 ? ? -39.90 148.71 94 14 LYS A 86 ? ? -98.20 46.39 95 14 SER A 95 ? ? -49.52 156.06 96 15 GLU A 23 ? ? -128.72 -60.08 97 15 ASP A 24 ? ? -108.84 46.20 98 15 ASN A 70 ? ? -37.29 114.83 99 15 ALA A 84 ? ? -34.07 95.70 100 15 GLN A 87 ? ? -117.63 51.08 101 16 ARG A 9 ? ? -102.20 46.21 102 16 PRO A 12 ? ? -69.77 0.44 103 16 GLU A 23 ? ? -126.30 -60.52 104 16 GLU A 60 ? ? -39.14 -32.66 105 16 SER A 76 ? ? 72.89 30.51 106 17 GLU A 23 ? ? -135.04 -45.80 107 17 ALA A 84 ? ? -41.27 108.43 108 17 LYS A 86 ? ? -112.20 62.16 109 17 PRO A 88 ? ? -69.76 -176.23 110 17 PRO A 94 ? ? -69.71 2.80 111 17 SER A 96 ? ? -38.50 119.49 112 18 ARG A 9 ? ? -84.43 37.15 113 18 ALA A 11 ? ? -38.95 150.62 114 18 PRO A 12 ? ? -69.81 -176.33 115 18 ARG A 13 ? ? -123.94 -54.89 116 18 ASP A 24 ? ? -105.71 50.50 117 18 PRO A 36 ? ? -47.98 -17.71 118 18 ASN A 50 ? ? 37.29 41.44 119 18 ALA A 84 ? ? -62.58 86.56 120 18 ASP A 91 ? ? -110.72 77.92 121 18 SER A 96 ? ? -46.57 151.46 122 19 GLU A 8 ? ? 71.29 42.12 123 19 GLU A 23 ? ? -133.66 -72.95 124 19 ASP A 24 ? ? -103.85 49.61 125 19 MET A 59 ? ? -35.18 -37.58 126 19 ARG A 85 ? ? -89.37 41.87 127 19 SER A 92 ? ? -171.28 145.08 128 20 ARG A 13 ? ? -102.02 -65.79 129 20 LYS A 14 ? ? -39.04 138.99 130 20 GLU A 23 ? ? -133.93 -44.97 131 20 MET A 59 ? ? -36.52 -37.02 132 20 ALA A 84 ? ? -36.73 147.47 #