data_1X62 # _entry.id 1X62 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X62 pdb_00001x62 10.2210/pdb1x62/pdb RCSB RCSB024424 ? ? WWPDB D_1000024424 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002002948.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X62 _pdbx_database_status.recvd_initial_deposition_date 2005-05-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Nagashima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the LIM domain of carboxyl terminal LIM domain protein 1' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'C-terminal LIM domain protein 1' 8573.706 1 ? ? 'LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LIM domain protein CLP-36, Elfin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002002948.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 ILE n 1 10 GLY n 1 11 ASN n 1 12 ALA n 1 13 GLN n 1 14 LYS n 1 15 LEU n 1 16 PRO n 1 17 MET n 1 18 CYS n 1 19 ASP n 1 20 LYS n 1 21 CYS n 1 22 GLY n 1 23 THR n 1 24 GLY n 1 25 ILE n 1 26 VAL n 1 27 GLY n 1 28 VAL n 1 29 PHE n 1 30 VAL n 1 31 LYS n 1 32 LEU n 1 33 ARG n 1 34 ASP n 1 35 ARG n 1 36 HIS n 1 37 ARG n 1 38 HIS n 1 39 PRO n 1 40 GLU n 1 41 CYS n 1 42 TYR n 1 43 VAL n 1 44 CYS n 1 45 THR n 1 46 ASP n 1 47 CYS n 1 48 GLY n 1 49 THR n 1 50 ASN n 1 51 LEU n 1 52 LYS n 1 53 GLN n 1 54 LYS n 1 55 GLY n 1 56 HIS n 1 57 PHE n 1 58 PHE n 1 59 VAL n 1 60 GLU n 1 61 ASP n 1 62 GLN n 1 63 ILE n 1 64 TYR n 1 65 CYS n 1 66 GLU n 1 67 LYS n 1 68 HIS n 1 69 ALA n 1 70 ARG n 1 71 GLU n 1 72 ARG n 1 73 VAL n 1 74 SER n 1 75 GLY n 1 76 PRO n 1 77 SER n 1 78 SER n 1 79 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'PDLIM1, CLIM1, CLP36' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040830-06 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PDLI1_HUMAN _struct_ref.pdbx_db_accession O00151 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERV _struct_ref.pdbx_align_begin 249 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X62 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00151 _struct_ref_seq.db_align_beg 249 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 314 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X62 GLY A 1 ? UNP O00151 ? ? 'cloning artifact' 1 1 1 1X62 SER A 2 ? UNP O00151 ? ? 'cloning artifact' 2 2 1 1X62 SER A 3 ? UNP O00151 ? ? 'cloning artifact' 3 3 1 1X62 GLY A 4 ? UNP O00151 ? ? 'cloning artifact' 4 4 1 1X62 SER A 5 ? UNP O00151 ? ? 'cloning artifact' 5 5 1 1X62 SER A 6 ? UNP O00151 ? ? 'cloning artifact' 6 6 1 1X62 GLY A 7 ? UNP O00151 ? ? 'cloning artifact' 7 7 1 1X62 SER A 74 ? UNP O00151 ? ? 'cloning artifact' 74 8 1 1X62 GLY A 75 ? UNP O00151 ? ? 'cloning artifact' 75 9 1 1X62 PRO A 76 ? UNP O00151 ? ? 'cloning artifact' 76 10 1 1X62 SER A 77 ? UNP O00151 ? ? 'cloning artifact' 77 11 1 1X62 SER A 78 ? UNP O00151 ? ? 'cloning artifact' 78 12 1 1X62 GLY A 79 ? UNP O00151 ? ? 'cloning artifact' 79 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.18mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3, 0.01mM ZnCl2' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 800 ? 2 INOVA Varian 900 ? # _pdbx_nmr_refine.entry_id 1X62 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1X62 _pdbx_nmr_details.text 'spectrometer_id 1 for 3D_15N_separated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY' # _pdbx_nmr_ensemble.entry_id 1X62 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X62 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9296 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 1X62 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X62 _struct.title 'Solution structure of the LIM domain of carboxyl terminal LIM domain protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X62 _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text ;LIM domain, PDZ and LIM domain protein 1, LIM domain protein CLP-36, C-terminal LIM domain protein 1, contractile protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 50 ? GLY A 55 ? ASN A 50 GLY A 55 1 ? 6 HELX_P HELX_P2 2 CYS A 65 ? SER A 74 ? CYS A 65 SER A 74 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? metalc3 metalc ? ? A HIS 38 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 38 A ZN 201 1_555 ? ? ? ? ? ? ? 2.082 ? ? metalc4 metalc ? ? A CYS 41 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 41 A ZN 201 1_555 ? ? ? ? ? ? ? 2.383 ? ? metalc5 metalc ? ? A CYS 44 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 44 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc6 metalc ? ? A CYS 47 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 47 A ZN 401 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc7 metalc ? ? A CYS 65 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 65 A ZN 401 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc8 metalc ? ? A HIS 68 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 68 A ZN 401 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 30 ? LYS A 31 ? VAL A 30 LYS A 31 A 2 HIS A 36 ? ARG A 37 ? HIS A 36 ARG A 37 B 1 PHE A 57 ? PHE A 58 ? PHE A 57 PHE A 58 B 2 ILE A 63 ? TYR A 64 ? ILE A 63 TYR A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 30 ? N VAL A 30 O ARG A 37 ? O ARG A 37 B 1 2 N PHE A 57 ? N PHE A 57 O TYR A 64 ? O TYR A 64 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 5 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 38 ? HIS A 38 . ? 1_555 ? 4 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 5 AC2 5 CYS A 44 ? CYS A 44 . ? 1_555 ? 6 AC2 5 ASP A 46 ? ASP A 46 . ? 1_555 ? 7 AC2 5 CYS A 47 ? CYS A 47 . ? 1_555 ? 8 AC2 5 CYS A 65 ? CYS A 65 . ? 1_555 ? 9 AC2 5 HIS A 68 ? HIS A 68 . ? 1_555 ? # _database_PDB_matrix.entry_id 1X62 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X62 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLY 79 79 79 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 93.6 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 104.9 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 108.3 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 105.8 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 116.7 ? 6 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 122.5 ? 7 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 47 ? A CYS 47 ? 1_555 105.3 ? 8 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 65 ? A CYS 65 ? 1_555 104.5 ? 9 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 65 ? A CYS 65 ? 1_555 107.3 ? 10 SG ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 68 ? A HIS 68 ? 1_555 128.0 ? 11 SG ? A CYS 47 ? A CYS 47 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 68 ? A HIS 68 ? 1_555 103.9 ? 12 SG ? A CYS 65 ? A CYS 65 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 68 ? A HIS 68 ? 1_555 106.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 16 ? ? -69.76 91.70 2 1 ARG A 33 ? ? -31.97 -72.04 3 1 CYS A 47 ? ? -93.83 -63.34 4 1 GLU A 66 ? ? -33.41 -36.89 5 1 PRO A 76 ? ? -69.75 -179.32 6 2 ARG A 33 ? ? -32.10 -76.06 7 2 TYR A 42 ? ? -69.85 6.18 8 2 ASN A 50 ? ? -55.22 107.64 9 2 GLN A 53 ? ? -97.54 -60.81 10 2 PRO A 76 ? ? -69.75 2.78 11 3 ARG A 33 ? ? -32.05 -72.70 12 3 TYR A 42 ? ? -45.26 -19.09 13 3 GLN A 53 ? ? -92.81 -65.39 14 3 VAL A 73 ? ? -39.96 -25.11 15 4 PRO A 16 ? ? -69.77 95.02 16 4 ARG A 33 ? ? -32.01 -72.68 17 4 CYS A 47 ? ? -92.62 -63.87 18 4 GLU A 66 ? ? -33.97 -39.75 19 5 PRO A 16 ? ? -69.77 91.23 20 5 ARG A 33 ? ? -32.61 -74.24 21 5 CYS A 47 ? ? -91.52 -60.81 22 6 LYS A 20 ? ? -66.08 -70.43 23 6 ARG A 33 ? ? -31.99 -74.49 24 6 CYS A 47 ? ? -90.17 -60.44 25 6 ASN A 50 ? ? -57.15 108.74 26 6 PRO A 76 ? ? -69.72 -178.15 27 7 ARG A 33 ? ? -32.26 -73.68 28 7 CYS A 47 ? ? -95.94 -63.88 29 7 ASN A 50 ? ? -58.97 109.90 30 8 CYS A 21 ? ? -94.43 -69.06 31 8 ARG A 33 ? ? -32.44 -74.15 32 8 CYS A 47 ? ? -94.26 -62.44 33 9 PRO A 16 ? ? -69.78 92.50 34 9 ARG A 33 ? ? -32.01 -73.59 35 9 CYS A 47 ? ? -92.70 -64.13 36 9 GLN A 53 ? ? -94.66 -61.52 37 10 ARG A 33 ? ? -32.02 -75.26 38 10 PRO A 76 ? ? -69.73 11.66 39 11 PRO A 16 ? ? -69.76 97.30 40 11 ARG A 33 ? ? -32.01 -76.04 41 12 CYS A 21 ? ? -97.59 -67.35 42 12 ARG A 33 ? ? -32.00 -73.44 43 12 CYS A 47 ? ? -93.68 -62.38 44 12 ASN A 50 ? ? -58.60 109.19 45 13 ARG A 33 ? ? -33.30 -73.79 46 14 PRO A 16 ? ? -69.76 94.16 47 14 ARG A 33 ? ? -32.02 -73.48 48 14 CYS A 47 ? ? -92.56 -64.42 49 14 GLU A 66 ? ? -32.71 -39.79 50 15 ASP A 34 ? ? 32.66 28.89 51 15 CYS A 47 ? ? -93.30 -62.43 52 15 ALA A 69 ? ? -37.88 -39.97 53 16 PRO A 16 ? ? -69.79 94.35 54 16 ARG A 33 ? ? -32.04 -73.06 55 16 CYS A 47 ? ? -91.19 -61.76 56 16 GLU A 66 ? ? -32.05 -36.59 57 17 CYS A 21 ? ? -97.34 -68.78 58 17 THR A 23 ? ? -97.99 -68.74 59 17 ILE A 25 ? ? -55.81 102.04 60 17 ARG A 33 ? ? -31.96 -74.72 61 17 CYS A 47 ? ? -94.77 -64.19 62 17 VAL A 73 ? ? -36.13 -31.13 63 18 CYS A 21 ? ? -95.53 -63.67 64 18 ARG A 33 ? ? -31.96 -73.28 65 18 CYS A 47 ? ? -94.03 -64.11 66 19 PRO A 16 ? ? -69.76 96.11 67 19 ARG A 33 ? ? -31.96 -73.21 68 19 CYS A 47 ? ? -93.81 -63.14 69 19 ASN A 50 ? ? -54.59 109.78 70 19 PRO A 76 ? ? -69.70 2.65 71 20 CYS A 21 ? ? -96.60 -69.58 72 20 ARG A 33 ? ? -31.96 -73.76 73 20 CYS A 47 ? ? -92.65 -66.46 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #