data_1X6H # _entry.id 1X6H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X6H pdb_00001x6h 10.2210/pdb1x6h/pdb RCSB RCSB024439 ? ? WWPDB D_1000024439 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X6H _pdbx_database_status.recvd_initial_deposition_date 2005-05-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001000882.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Saito, K.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structures of the C2H2 type zinc finger domain of human Transcriptional repressor CTCF' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Saito, K.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional repressor CTCF' 9339.353 1 ? ? 'C2H2 type zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CCCTC-binding factor, CTCFL paralog, 11-zinc finger protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGEN SGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGEN SGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001000882.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ARG n 1 9 THR n 1 10 HIS n 1 11 THR n 1 12 GLY n 1 13 GLU n 1 14 LYS n 1 15 PRO n 1 16 TYR n 1 17 ALA n 1 18 CYS n 1 19 SER n 1 20 HIS n 1 21 CYS n 1 22 ASP n 1 23 LYS n 1 24 THR n 1 25 PHE n 1 26 ARG n 1 27 GLN n 1 28 LYS n 1 29 GLN n 1 30 LEU n 1 31 LEU n 1 32 ASP n 1 33 MET n 1 34 HIS n 1 35 PHE n 1 36 LYS n 1 37 ARG n 1 38 TYR n 1 39 HIS n 1 40 ASP n 1 41 PRO n 1 42 ASN n 1 43 PHE n 1 44 VAL n 1 45 PRO n 1 46 ALA n 1 47 ALA n 1 48 PHE n 1 49 VAL n 1 50 CYS n 1 51 SER n 1 52 LYS n 1 53 CYS n 1 54 GLY n 1 55 LYS n 1 56 THR n 1 57 PHE n 1 58 THR n 1 59 ARG n 1 60 ARG n 1 61 ASN n 1 62 THR n 1 63 MET n 1 64 ALA n 1 65 ARG n 1 66 HIS n 1 67 ALA n 1 68 ASP n 1 69 ASN n 1 70 CYS n 1 71 ALA n 1 72 GLY n 1 73 PRO n 1 74 ASP n 1 75 GLY n 1 76 VAL n 1 77 GLU n 1 78 GLY n 1 79 GLU n 1 80 ASN n 1 81 SER n 1 82 GLY n 1 83 PRO n 1 84 SER n 1 85 SER n 1 86 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CTCF _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040719-09 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 1X6H _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1X6H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1X6H _struct.title 'Solution structures of the C2H2 type zinc finger domain of human Transcriptional repressor CTCF' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X6H _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;zinc finger protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CTCF_HUMAN _struct_ref.pdbx_db_accession P49711 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGEN _struct_ref.pdbx_align_begin 515 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X6H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49711 _struct_ref_seq.db_align_beg 515 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 587 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 80 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X6H GLY A 1 ? UNP P49711 ? ? 'cloning artifact' 1 1 1 1X6H SER A 2 ? UNP P49711 ? ? 'cloning artifact' 2 2 1 1X6H SER A 3 ? UNP P49711 ? ? 'cloning artifact' 3 3 1 1X6H GLY A 4 ? UNP P49711 ? ? 'cloning artifact' 4 4 1 1X6H SER A 5 ? UNP P49711 ? ? 'cloning artifact' 5 5 1 1X6H SER A 6 ? UNP P49711 ? ? 'cloning artifact' 6 6 1 1X6H GLY A 7 ? UNP P49711 ? ? 'cloning artifact' 7 7 1 1X6H SER A 81 ? UNP P49711 ? ? 'cloning artifact' 81 8 1 1X6H GLY A 82 ? UNP P49711 ? ? 'cloning artifact' 82 9 1 1X6H PRO A 83 ? UNP P49711 ? ? 'cloning artifact' 83 10 1 1X6H SER A 84 ? UNP P49711 ? ? 'cloning artifact' 84 11 1 1X6H SER A 85 ? UNP P49711 ? ? 'cloning artifact' 85 12 1 1X6H GLY A 86 ? UNP P49711 ? ? 'cloning artifact' 86 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 27 ? TYR A 38 ? GLN A 27 TYR A 38 1 ? 12 HELX_P HELX_P2 2 ARG A 59 ? CYS A 70 ? ARG A 59 CYS A 70 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.372 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc3 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 34 A ZN 201 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc4 metalc ? ? A HIS 39 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 39 A ZN 201 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc5 metalc ? ? A CYS 50 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 50 A ZN 401 1_555 ? ? ? ? ? ? ? 2.350 ? ? metalc6 metalc ? ? A CYS 53 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 53 A ZN 401 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc7 metalc ? ? A HIS 66 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 66 A ZN 401 1_555 ? ? ? ? ? ? ? 2.367 ? ? metalc8 metalc ? ? A CYS 70 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 70 A ZN 401 1_555 ? ? ? ? ? ? ? 2.327 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 110.5 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 115.5 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 86.8 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 108.8 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 117.4 ? 6 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 116.6 ? 7 SG ? A CYS 50 ? A CYS 50 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 53 ? A CYS 53 ? 1_555 117.8 ? 8 SG ? A CYS 50 ? A CYS 50 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 98.3 ? 9 SG ? A CYS 53 ? A CYS 53 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 113.6 ? 10 SG ? A CYS 50 ? A CYS 50 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 117.7 ? 11 SG ? A CYS 53 ? A CYS 53 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 112.2 ? 12 NE2 ? A HIS 66 ? A HIS 66 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 93.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 16 ? ALA A 17 ? TYR A 16 ALA A 17 A 2 THR A 24 ? PHE A 25 ? THR A 24 PHE A 25 B 1 PHE A 48 ? VAL A 49 ? PHE A 48 VAL A 49 B 2 THR A 56 ? PHE A 57 ? THR A 56 PHE A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 16 ? N TYR A 16 O PHE A 25 ? O PHE A 25 B 1 2 N PHE A 48 ? N PHE A 48 O PHE A 57 ? O PHE A 57 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 34 ? HIS A 34 . ? 1_555 ? 4 AC1 4 HIS A 39 ? HIS A 39 . ? 1_555 ? 5 AC2 4 CYS A 50 ? CYS A 50 . ? 1_555 ? 6 AC2 4 CYS A 53 ? CYS A 53 . ? 1_555 ? 7 AC2 4 HIS A 66 ? HIS A 66 . ? 1_555 ? 8 AC2 4 CYS A 70 ? CYS A 70 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 35.05 42.10 2 1 HIS A 10 ? ? -163.76 107.13 3 1 GLU A 13 ? ? -41.69 105.32 4 1 LYS A 14 ? ? -40.94 106.90 5 1 ASP A 22 ? ? -97.55 49.32 6 1 ARG A 37 ? ? -97.08 -61.39 7 1 PRO A 41 ? ? -69.75 1.57 8 1 CYS A 50 ? ? -54.04 174.70 9 1 SER A 81 ? ? -170.36 136.45 10 2 SER A 5 ? ? 34.32 43.33 11 2 GLU A 13 ? ? -167.01 108.89 12 2 ASP A 22 ? ? -96.16 45.62 13 2 ARG A 37 ? ? -96.10 -62.60 14 2 PRO A 41 ? ? -69.78 2.08 15 2 SER A 81 ? ? -35.99 118.97 16 3 THR A 11 ? ? -100.60 41.99 17 3 LYS A 14 ? ? -49.69 106.56 18 3 ASP A 22 ? ? -103.04 53.68 19 3 ARG A 37 ? ? -97.07 -62.32 20 3 PRO A 83 ? ? -69.80 -177.01 21 4 SER A 2 ? ? -168.29 112.91 22 4 ARG A 37 ? ? -97.10 -62.11 23 4 PRO A 41 ? ? -69.82 2.35 24 4 GLU A 77 ? ? -126.80 -61.15 25 4 ASN A 80 ? ? -174.72 139.25 26 5 HIS A 10 ? ? -99.67 42.01 27 5 LYS A 14 ? ? -41.79 102.45 28 5 ASP A 22 ? ? -97.43 51.07 29 5 ARG A 37 ? ? -96.81 -62.38 30 5 PRO A 41 ? ? -69.73 2.97 31 5 CYS A 50 ? ? -50.60 174.07 32 6 ASP A 22 ? ? -102.98 47.58 33 6 ARG A 37 ? ? -96.63 -62.53 34 6 PRO A 41 ? ? -69.70 2.87 35 6 PRO A 73 ? ? -69.75 95.61 36 6 GLU A 77 ? ? -133.42 -42.39 37 7 ASP A 22 ? ? -98.30 52.32 38 7 ARG A 37 ? ? -97.03 -61.51 39 7 CYS A 50 ? ? -45.72 168.22 40 7 ALA A 71 ? ? -134.17 -35.80 41 7 ASP A 74 ? ? 36.51 41.35 42 7 SER A 81 ? ? -34.74 141.84 43 8 HIS A 10 ? ? -37.14 131.77 44 8 ASP A 22 ? ? -99.14 43.57 45 8 ARG A 37 ? ? -96.47 -60.90 46 8 CYS A 50 ? ? -54.45 172.01 47 8 THR A 58 ? ? -88.68 33.25 48 9 ASP A 22 ? ? -100.86 51.80 49 9 ARG A 37 ? ? -97.22 -62.36 50 9 PRO A 41 ? ? -69.81 1.19 51 9 ASP A 74 ? ? -132.51 -55.05 52 10 LYS A 14 ? ? -50.55 106.81 53 10 ASP A 22 ? ? -98.29 51.80 54 10 ARG A 37 ? ? -97.23 -61.02 55 10 GLU A 79 ? ? -174.47 131.80 56 11 SER A 5 ? ? -44.00 155.55 57 11 SER A 6 ? ? -81.45 47.36 58 11 ARG A 8 ? ? -105.27 42.06 59 11 ASP A 22 ? ? -97.27 39.29 60 11 ARG A 37 ? ? -96.95 -62.69 61 11 PRO A 41 ? ? -69.77 4.60 62 11 ALA A 71 ? ? -132.44 -42.13 63 11 PRO A 73 ? ? -69.82 7.37 64 12 SER A 5 ? ? -64.08 84.14 65 12 SER A 6 ? ? -38.27 152.80 66 12 HIS A 10 ? ? -171.53 125.35 67 12 ARG A 37 ? ? -96.76 -62.29 68 12 CYS A 50 ? ? -53.34 174.07 69 12 PRO A 83 ? ? -69.82 -179.50 70 13 ARG A 8 ? ? -55.05 104.57 71 13 THR A 11 ? ? -35.09 114.42 72 13 ASP A 22 ? ? -103.58 54.16 73 13 ARG A 37 ? ? -97.11 -61.10 74 13 PRO A 41 ? ? -69.80 2.85 75 13 PRO A 73 ? ? -69.80 89.76 76 13 GLU A 77 ? ? -174.90 118.49 77 13 SER A 81 ? ? 37.77 43.97 78 14 ASP A 22 ? ? -99.69 50.74 79 14 ARG A 37 ? ? -97.11 -62.43 80 14 PRO A 41 ? ? -69.79 4.03 81 14 CYS A 50 ? ? -49.16 174.76 82 14 PRO A 73 ? ? -69.77 88.39 83 14 SER A 84 ? ? -163.62 114.16 84 15 SER A 3 ? ? -68.35 88.04 85 15 SER A 6 ? ? -45.88 101.66 86 15 ASP A 22 ? ? -99.00 50.55 87 15 ARG A 37 ? ? -94.47 -61.17 88 15 ALA A 71 ? ? -132.39 -40.85 89 15 ASP A 74 ? ? -174.25 127.86 90 16 ASP A 22 ? ? -106.08 49.47 91 16 ARG A 37 ? ? -98.43 -62.93 92 16 PRO A 41 ? ? -69.75 6.32 93 16 VAL A 44 ? ? -162.27 108.58 94 16 ASN A 61 ? ? -36.46 -37.17 95 16 ASP A 74 ? ? -173.81 125.42 96 16 PRO A 83 ? ? -69.82 -168.58 97 17 HIS A 10 ? ? -92.05 38.12 98 17 ASP A 22 ? ? -99.95 33.19 99 17 ARG A 37 ? ? -98.33 -63.19 100 17 PRO A 41 ? ? -69.83 5.95 101 17 PRO A 73 ? ? -69.73 -179.71 102 17 VAL A 76 ? ? -171.86 128.63 103 17 PRO A 83 ? ? -69.73 98.29 104 18 SER A 6 ? ? -82.45 42.00 105 18 GLU A 13 ? ? -170.63 137.35 106 18 ASP A 22 ? ? -91.58 31.43 107 18 ARG A 37 ? ? -94.09 -61.98 108 18 PRO A 41 ? ? -69.77 2.54 109 18 CYS A 50 ? ? -51.32 175.86 110 18 VAL A 76 ? ? -132.12 -56.30 111 19 SER A 2 ? ? -82.00 47.55 112 19 ASP A 22 ? ? -97.22 48.54 113 19 ARG A 37 ? ? -97.16 -62.85 114 19 PRO A 41 ? ? -69.78 3.57 115 19 VAL A 44 ? ? -160.93 112.03 116 19 VAL A 76 ? ? -173.61 135.41 117 19 ASN A 80 ? ? -174.82 128.11 118 20 THR A 9 ? ? 28.76 43.79 119 20 HIS A 10 ? ? -134.35 -63.65 120 20 ASP A 22 ? ? -99.26 48.90 121 20 GLN A 29 ? ? -38.76 -37.74 122 20 ARG A 37 ? ? -97.11 -62.11 123 20 PRO A 41 ? ? -69.70 2.99 124 20 CYS A 50 ? ? -52.10 176.80 125 20 SER A 84 ? ? -173.04 114.40 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 1X6H _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X6H _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.5mM C2H2 type zinc finger domain U-15N,13C; 20mM d-Tris HCl; 100mM NaCl; 5mM d-DTT; 0.02% NaN3; 10uM ZnCl2; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 1X6H _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LEU N N N N 158 LEU CA C N S 159 LEU C C N N 160 LEU O O N N 161 LEU CB C N N 162 LEU CG C N N 163 LEU CD1 C N N 164 LEU CD2 C N N 165 LEU OXT O N N 166 LEU H H N N 167 LEU H2 H N N 168 LEU HA H N N 169 LEU HB2 H N N 170 LEU HB3 H N N 171 LEU HG H N N 172 LEU HD11 H N N 173 LEU HD12 H N N 174 LEU HD13 H N N 175 LEU HD21 H N N 176 LEU HD22 H N N 177 LEU HD23 H N N 178 LEU HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 MET N N N N 205 MET CA C N S 206 MET C C N N 207 MET O O N N 208 MET CB C N N 209 MET CG C N N 210 MET SD S N N 211 MET CE C N N 212 MET OXT O N N 213 MET H H N N 214 MET H2 H N N 215 MET HA H N N 216 MET HB2 H N N 217 MET HB3 H N N 218 MET HG2 H N N 219 MET HG3 H N N 220 MET HE1 H N N 221 MET HE2 H N N 222 MET HE3 H N N 223 MET HXT H N N 224 PHE N N N N 225 PHE CA C N S 226 PHE C C N N 227 PHE O O N N 228 PHE CB C N N 229 PHE CG C Y N 230 PHE CD1 C Y N 231 PHE CD2 C Y N 232 PHE CE1 C Y N 233 PHE CE2 C Y N 234 PHE CZ C Y N 235 PHE OXT O N N 236 PHE H H N N 237 PHE H2 H N N 238 PHE HA H N N 239 PHE HB2 H N N 240 PHE HB3 H N N 241 PHE HD1 H N N 242 PHE HD2 H N N 243 PHE HE1 H N N 244 PHE HE2 H N N 245 PHE HZ H N N 246 PHE HXT H N N 247 PRO N N N N 248 PRO CA C N S 249 PRO C C N N 250 PRO O O N N 251 PRO CB C N N 252 PRO CG C N N 253 PRO CD C N N 254 PRO OXT O N N 255 PRO H H N N 256 PRO HA H N N 257 PRO HB2 H N N 258 PRO HB3 H N N 259 PRO HG2 H N N 260 PRO HG3 H N N 261 PRO HD2 H N N 262 PRO HD3 H N N 263 PRO HXT H N N 264 SER N N N N 265 SER CA C N S 266 SER C C N N 267 SER O O N N 268 SER CB C N N 269 SER OG O N N 270 SER OXT O N N 271 SER H H N N 272 SER H2 H N N 273 SER HA H N N 274 SER HB2 H N N 275 SER HB3 H N N 276 SER HG H N N 277 SER HXT H N N 278 THR N N N N 279 THR CA C N S 280 THR C C N N 281 THR O O N N 282 THR CB C N R 283 THR OG1 O N N 284 THR CG2 C N N 285 THR OXT O N N 286 THR H H N N 287 THR H2 H N N 288 THR HA H N N 289 THR HB H N N 290 THR HG1 H N N 291 THR HG21 H N N 292 THR HG22 H N N 293 THR HG23 H N N 294 THR HXT H N N 295 TYR N N N N 296 TYR CA C N S 297 TYR C C N N 298 TYR O O N N 299 TYR CB C N N 300 TYR CG C Y N 301 TYR CD1 C Y N 302 TYR CD2 C Y N 303 TYR CE1 C Y N 304 TYR CE2 C Y N 305 TYR CZ C Y N 306 TYR OH O N N 307 TYR OXT O N N 308 TYR H H N N 309 TYR H2 H N N 310 TYR HA H N N 311 TYR HB2 H N N 312 TYR HB3 H N N 313 TYR HD1 H N N 314 TYR HD2 H N N 315 TYR HE1 H N N 316 TYR HE2 H N N 317 TYR HH H N N 318 TYR HXT H N N 319 VAL N N N N 320 VAL CA C N S 321 VAL C C N N 322 VAL O O N N 323 VAL CB C N N 324 VAL CG1 C N N 325 VAL CG2 C N N 326 VAL OXT O N N 327 VAL H H N N 328 VAL H2 H N N 329 VAL HA H N N 330 VAL HB H N N 331 VAL HG11 H N N 332 VAL HG12 H N N 333 VAL HG13 H N N 334 VAL HG21 H N N 335 VAL HG22 H N N 336 VAL HG23 H N N 337 VAL HXT H N N 338 ZN ZN ZN N N 339 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1X6H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_