data_1XAS # _entry.id 1XAS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1XAS WWPDB D_1000177242 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XAS _pdbx_database_status.recvd_initial_deposition_date 1994-05-31 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Derewenda, U.' 1 'Derewenda, Z.S.' 2 # _citation.id primary _citation.title 'Crystal structure, at 2.6-A resolution, of the Streptomyces lividans xylanase A, a member of the F family of beta-1,4-D-glycanases.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 269 _citation.page_first 20811 _citation.page_last 20814 _citation.year 1994 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8063693 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Derewenda, U.' 1 ? primary 'Swenson, L.' 2 ? primary 'Green, R.' 3 ? primary 'Wei, Y.' 4 ? primary 'Morosoli, R.' 5 ? primary 'Shareck, F.' 6 ? primary 'Kluepfel, D.' 7 ? primary 'Derewenda, Z.S.' 8 ? # _cell.entry_id 1XAS _cell.length_a 69.520 _cell.length_b 46.510 _cell.length_c 85.500 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XAS _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '1,4-BETA-D-XYLAN XYLANOHYDROLASE' _entity.formula_weight 32971.395 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.8 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AESTLGAAAAQSGRYFGTAIASGRLSDSTYTSIAGREFNMVTAENEMKIDATEPQRGQFNFSSADRVYNWAVQNGKQVRG HTLAWHSQQPGWMQSLSGRPLRQAMIDHINGVMAHYKGKIVQWDVVNEAFADGSSGARRDSNLQRSGNDWIEVAFRTARA ADPSAKLCYNDYNVENWTWAKTQAMYNMVRDFKQRGVPIDCVGFQSHFNSGSPYNSNFRTTLQNFAALGVDVAITELDIQ GAPASTYANVTNDCLAVSRCLGITVWGVRDSDSWRSEQTPLLFNNDGSKKAAYTAVLDA ; _entity_poly.pdbx_seq_one_letter_code_can ;AESTLGAAAAQSGRYFGTAIASGRLSDSTYTSIAGREFNMVTAENEMKIDATEPQRGQFNFSSADRVYNWAVQNGKQVRG HTLAWHSQQPGWMQSLSGRPLRQAMIDHINGVMAHYKGKIVQWDVVNEAFADGSSGARRDSNLQRSGNDWIEVAFRTARA ADPSAKLCYNDYNVENWTWAKTQAMYNMVRDFKQRGVPIDCVGFQSHFNSGSPYNSNFRTTLQNFAALGVDVAITELDIQ GAPASTYANVTNDCLAVSRCLGITVWGVRDSDSWRSEQTPLLFNNDGSKKAAYTAVLDA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 SER n 1 4 THR n 1 5 LEU n 1 6 GLY n 1 7 ALA n 1 8 ALA n 1 9 ALA n 1 10 ALA n 1 11 GLN n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 TYR n 1 16 PHE n 1 17 GLY n 1 18 THR n 1 19 ALA n 1 20 ILE n 1 21 ALA n 1 22 SER n 1 23 GLY n 1 24 ARG n 1 25 LEU n 1 26 SER n 1 27 ASP n 1 28 SER n 1 29 THR n 1 30 TYR n 1 31 THR n 1 32 SER n 1 33 ILE n 1 34 ALA n 1 35 GLY n 1 36 ARG n 1 37 GLU n 1 38 PHE n 1 39 ASN n 1 40 MET n 1 41 VAL n 1 42 THR n 1 43 ALA n 1 44 GLU n 1 45 ASN n 1 46 GLU n 1 47 MET n 1 48 LYS n 1 49 ILE n 1 50 ASP n 1 51 ALA n 1 52 THR n 1 53 GLU n 1 54 PRO n 1 55 GLN n 1 56 ARG n 1 57 GLY n 1 58 GLN n 1 59 PHE n 1 60 ASN n 1 61 PHE n 1 62 SER n 1 63 SER n 1 64 ALA n 1 65 ASP n 1 66 ARG n 1 67 VAL n 1 68 TYR n 1 69 ASN n 1 70 TRP n 1 71 ALA n 1 72 VAL n 1 73 GLN n 1 74 ASN n 1 75 GLY n 1 76 LYS n 1 77 GLN n 1 78 VAL n 1 79 ARG n 1 80 GLY n 1 81 HIS n 1 82 THR n 1 83 LEU n 1 84 ALA n 1 85 TRP n 1 86 HIS n 1 87 SER n 1 88 GLN n 1 89 GLN n 1 90 PRO n 1 91 GLY n 1 92 TRP n 1 93 MET n 1 94 GLN n 1 95 SER n 1 96 LEU n 1 97 SER n 1 98 GLY n 1 99 ARG n 1 100 PRO n 1 101 LEU n 1 102 ARG n 1 103 GLN n 1 104 ALA n 1 105 MET n 1 106 ILE n 1 107 ASP n 1 108 HIS n 1 109 ILE n 1 110 ASN n 1 111 GLY n 1 112 VAL n 1 113 MET n 1 114 ALA n 1 115 HIS n 1 116 TYR n 1 117 LYS n 1 118 GLY n 1 119 LYS n 1 120 ILE n 1 121 VAL n 1 122 GLN n 1 123 TRP n 1 124 ASP n 1 125 VAL n 1 126 VAL n 1 127 ASN n 1 128 GLU n 1 129 ALA n 1 130 PHE n 1 131 ALA n 1 132 ASP n 1 133 GLY n 1 134 SER n 1 135 SER n 1 136 GLY n 1 137 ALA n 1 138 ARG n 1 139 ARG n 1 140 ASP n 1 141 SER n 1 142 ASN n 1 143 LEU n 1 144 GLN n 1 145 ARG n 1 146 SER n 1 147 GLY n 1 148 ASN n 1 149 ASP n 1 150 TRP n 1 151 ILE n 1 152 GLU n 1 153 VAL n 1 154 ALA n 1 155 PHE n 1 156 ARG n 1 157 THR n 1 158 ALA n 1 159 ARG n 1 160 ALA n 1 161 ALA n 1 162 ASP n 1 163 PRO n 1 164 SER n 1 165 ALA n 1 166 LYS n 1 167 LEU n 1 168 CYS n 1 169 TYR n 1 170 ASN n 1 171 ASP n 1 172 TYR n 1 173 ASN n 1 174 VAL n 1 175 GLU n 1 176 ASN n 1 177 TRP n 1 178 THR n 1 179 TRP n 1 180 ALA n 1 181 LYS n 1 182 THR n 1 183 GLN n 1 184 ALA n 1 185 MET n 1 186 TYR n 1 187 ASN n 1 188 MET n 1 189 VAL n 1 190 ARG n 1 191 ASP n 1 192 PHE n 1 193 LYS n 1 194 GLN n 1 195 ARG n 1 196 GLY n 1 197 VAL n 1 198 PRO n 1 199 ILE n 1 200 ASP n 1 201 CYS n 1 202 VAL n 1 203 GLY n 1 204 PHE n 1 205 GLN n 1 206 SER n 1 207 HIS n 1 208 PHE n 1 209 ASN n 1 210 SER n 1 211 GLY n 1 212 SER n 1 213 PRO n 1 214 TYR n 1 215 ASN n 1 216 SER n 1 217 ASN n 1 218 PHE n 1 219 ARG n 1 220 THR n 1 221 THR n 1 222 LEU n 1 223 GLN n 1 224 ASN n 1 225 PHE n 1 226 ALA n 1 227 ALA n 1 228 LEU n 1 229 GLY n 1 230 VAL n 1 231 ASP n 1 232 VAL n 1 233 ALA n 1 234 ILE n 1 235 THR n 1 236 GLU n 1 237 LEU n 1 238 ASP n 1 239 ILE n 1 240 GLN n 1 241 GLY n 1 242 ALA n 1 243 PRO n 1 244 ALA n 1 245 SER n 1 246 THR n 1 247 TYR n 1 248 ALA n 1 249 ASN n 1 250 VAL n 1 251 THR n 1 252 ASN n 1 253 ASP n 1 254 CYS n 1 255 LEU n 1 256 ALA n 1 257 VAL n 1 258 SER n 1 259 ARG n 1 260 CYS n 1 261 LEU n 1 262 GLY n 1 263 ILE n 1 264 THR n 1 265 VAL n 1 266 TRP n 1 267 GLY n 1 268 VAL n 1 269 ARG n 1 270 ASP n 1 271 SER n 1 272 ASP n 1 273 SER n 1 274 TRP n 1 275 ARG n 1 276 SER n 1 277 GLU n 1 278 GLN n 1 279 THR n 1 280 PRO n 1 281 LEU n 1 282 LEU n 1 283 PHE n 1 284 ASN n 1 285 ASN n 1 286 ASP n 1 287 GLY n 1 288 SER n 1 289 LYS n 1 290 LYS n 1 291 ALA n 1 292 ALA n 1 293 TYR n 1 294 THR n 1 295 ALA n 1 296 VAL n 1 297 LEU n 1 298 ASP n 1 299 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces lividans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1916 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code XYNA_STRLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P26514 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MGSYALPRSGVRRSIRVLLAALVVGVLGTATALIAPPGAHAAESTLGAAAAQSGRYFGTAIASGRLSDSTYTSIAGREFN MVTAENEMKIDATEPQRGQFNFSSADRVYNWAVQNGKQVRGHTLAWHSQQPGWMQSLSGRPLRQAMIDHINGVMAHYKGK IVQWDVVNEAFADGSSGARRDSNLQRSGNDWIEVAFRTARAADPSAKLCYNDYNVENWTWAKTQAMYNMVRDFKQRGVPI DCVGFQSHFNSGSPYNSNFRTTLQNFAALGVDVAITELDIQGAPASTYANVTNDCLAVSRCLGITVWGVRDSDSWRSEQT PLLFNNDGSKKAAYTAVLDALNGGDSSEPPADGGQIKGVGSGRCLDVPDASTSDGTQLQLWDCHSGTNQQWAATDAGELR VYGDKCLDAAGTSNGSKVQIYSCWGGDNQKWRLNSDGSVVGVQSGLCLDAVGNGTANGTLIQLYTCSNGSNQRWTRT ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XAS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 299 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26514 _struct_ref_seq.db_align_beg 42 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 340 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 299 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1XAS _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_percent_sol 41.31 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _refine.entry_id 1XAS _refine.ls_number_reflns_obs 8008 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 2.6 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.2100000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2100000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 295 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 295 _refine_hist.d_res_high 2.6 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 0.379 1.000 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 0.636 1.500 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 0.679 1.500 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 1.077 2.000 ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1XAS _struct.title ;CRYSTAL STRUCTURE, AT 2.6 ANGSTROMS RESOLUTION, OF THE STREPTOMYCES LIVIDANS XYLANASE A, A MEMBER OF THE F FAMILY OF BETA-1,4-D-GLYCANSES ; _struct.pdbx_descriptor '1,4-BETA-D-XYLAN XYLANOHYDROLASE (E.C.3.2.1.8)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XAS _struct_keywords.pdbx_keywords 'XYLANASE A' _struct_keywords.text 'XYLANASE A' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H0 GLY A 6 ? ALA A 9 ? GLY A 6 ALA A 9 1 ? 4 HELX_P HELX_P2 H1 ILE A 20 ? GLU A 37 ? ILE A 20 GLU A 37 1 ? 18 HELX_P HELX_P3 "H'" ILE A 49 ? THR A 52 ? ILE A 49 THR A 52 1 ? 4 HELX_P HELX_P4 H2 SER A 62 ? GLN A 73 ? SER A 62 GLN A 73 1 ? 12 HELX_P HELX_P5 "H'" GLY A 91 ? GLN A 94 ? GLY A 91 GLN A 94 1 ? 4 HELX_P HELX_P6 H3 GLY A 98 ? TYR A 116 ? GLY A 98 TYR A 116 1 ? 19 HELX_P HELX_P7 H4 TRP A 150 ? ALA A 161 ? TRP A 150 ALA A 161 1 ? 12 HELX_P HELX_P8 H5 ALA A 180 ? ARG A 195 ? ALA A 180 ARG A 195 1 ? 16 HELX_P HELX_P9 H6 PHE A 218 ? ALA A 226 ? PHE A 218 ALA A 226 1 ? 9 HELX_P HELX_P10 H7 ALA A 244 ? CYS A 254 ? ALA A 244 CYS A 254 1 ? 11 HELX_P HELX_P11 H8 ALA A 291 ? ASP A 298 ? ALA A 291 ASP A 298 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? parallel S1 2 3 ? parallel S1 3 4 ? parallel S1 4 5 ? parallel S1 5 6 ? parallel S1 6 7 ? parallel S1 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 TYR A 15 ? ILE A 20 ? TYR A 15 ILE A 20 S1 2 MET A 40 ? GLU A 44 ? MET A 40 GLU A 44 S1 3 GLN A 77 ? ALA A 84 ? GLN A 77 ALA A 84 S1 4 VAL A 121 ? ASN A 127 ? VAL A 121 ASN A 127 S1 5 LYS A 166 ? ASP A 171 ? LYS A 166 ASP A 171 S1 6 ASP A 200 ? PHE A 208 ? ASP A 200 PHE A 208 S1 7 ASP A 231 ? GLN A 240 ? ASP A 231 GLN A 240 S1 8 LEU A 261 ? TRP A 266 ? LEU A 261 TRP A 266 # _struct_site.id CAT _struct_site.pdbx_evidence_code Author _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'CATALYTIC SITE' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAT 2 GLU A 128 ? GLU A 128 . ? 1_555 ? 2 CAT 2 GLU A 236 ? GLU A 236 . ? 1_555 ? # _database_PDB_matrix.entry_id 1XAS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XAS _atom_sites.fract_transf_matrix[1][1] 0.014384 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021501 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011696 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_type.symbol C # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 TRP 123 123 123 TRP TRP A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 TRP 150 150 150 TRP TRP A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 TRP 177 177 177 TRP TRP A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 MET 185 185 185 MET MET A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 ASN 187 187 187 ASN ASN A . n A 1 188 MET 188 188 188 MET MET A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 GLN 194 194 194 GLN GLN A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 ILE 199 199 199 ILE ILE A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 CYS 201 201 201 CYS CYS A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 PRO 213 213 213 PRO PRO A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 ASN 215 215 215 ASN ASN A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 ASN 217 217 217 ASN ASN A . n A 1 218 PHE 218 218 218 PHE PHE A . n A 1 219 ARG 219 219 219 ARG ARG A . n A 1 220 THR 220 220 220 THR THR A . n A 1 221 THR 221 221 221 THR THR A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 GLN 223 223 223 GLN GLN A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 GLU 236 236 236 GLU GLU A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 ASP 238 238 238 ASP ASP A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 GLN 240 240 240 GLN GLN A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 SER 245 245 245 SER SER A . n A 1 246 THR 246 246 246 THR THR A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 ASN 249 249 249 ASN ASN A . n A 1 250 VAL 250 250 250 VAL VAL A . n A 1 251 THR 251 251 251 THR THR A . n A 1 252 ASN 252 252 252 ASN ASN A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 CYS 254 254 254 CYS CYS A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 SER 258 258 258 SER SER A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 CYS 260 260 260 CYS CYS A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 THR 264 264 264 THR THR A . n A 1 265 VAL 265 265 265 VAL VAL A . n A 1 266 TRP 266 266 266 TRP TRP A . n A 1 267 GLY 267 267 267 GLY GLY A . n A 1 268 VAL 268 268 268 VAL VAL A . n A 1 269 ARG 269 269 269 ARG ARG A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 SER 271 271 271 SER SER A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 TRP 274 274 274 TRP TRP A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 SER 276 276 276 SER SER A . n A 1 277 GLU 277 277 277 GLU GLU A . n A 1 278 GLN 278 278 278 GLN GLN A . n A 1 279 THR 279 279 279 THR THR A . n A 1 280 PRO 280 280 280 PRO PRO A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 PHE 283 283 283 PHE PHE A . n A 1 284 ASN 284 284 284 ASN ASN A . n A 1 285 ASN 285 285 285 ASN ASN A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 SER 288 288 288 SER SER A . n A 1 289 LYS 289 289 289 LYS LYS A . n A 1 290 LYS 290 290 290 LYS LYS A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 TYR 293 293 293 TYR TYR A . n A 1 294 THR 294 294 294 THR THR A . n A 1 295 ALA 295 295 295 ALA ALA A . n A 1 296 VAL 296 296 296 VAL VAL A . n A 1 297 LEU 297 297 297 LEU LEU A . n A 1 298 ASP 298 298 298 ASP ASP A . n A 1 299 ALA 299 299 299 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-05-31 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-07-17 5 'Structure model' 1 4 2019-08-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' Other 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' software 3 5 'Structure model' software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_software.classification' 3 5 'Structure model' '_software.classification' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 PROLSQ refinement . ? 2 X-PLOR refinement . ? 3 X-PLOR phasing . ? 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A THR 4 ? A THR 4 # _pdbx_coordinate_model.asym_id A _pdbx_coordinate_model.type 'CA ATOMS ONLY' #