data_1XAT # _entry.id 1XAT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1XAT WWPDB D_1000177243 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XAT _pdbx_database_status.recvd_initial_deposition_date 1998-03-11 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Beaman, T.W.' 1 'Sugantino, M.' 2 'Roderick, S.L.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of the hexapeptide xenobiotic acetyltransferase from Pseudomonas aeruginosa.' Biochemistry 37 6689 6696 1998 BICHAW US 0006-2960 0033 ? 9578552 10.1021/bi980106v 1 'Purification and Crystallization of Pseudomonas Aeruginosa Chloramphenicol Acetyltransferase' Proteins 28 298 ? 1997 PSFGEY US 0887-3585 0867 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Beaman, T.W.' 1 primary 'Sugantino, M.' 2 primary 'Roderick, S.L.' 3 1 'Tian, Y.' 4 1 'Beaman, T.W.' 5 1 'Roderick, S.L.' 6 # _cell.entry_id 1XAT _cell.length_a 154.800 _cell.length_b 154.800 _cell.length_c 154.800 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XAT _symmetry.space_group_name_H-M 'P 41 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 213 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'XENOBIOTIC ACETYLTRANSFERASE' _entity.formula_weight 23506.443 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGNYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHR AEWASTFPFHFMHEEPAFAGAVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPART IRKRFSDGDIQNLLEMAWWDWPLADIEAAMPLLCTGDIPALYQHWKQRQATA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGNYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHR AEWASTFPFHFMHEEPAFAGAVNGYQPAGDTLIGHEVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPART IRKRFSDGDIQNLLEMAWWDWPLADIEAAMPLLCTGDIPALYQHWKQRQATA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 TYR n 1 5 PHE n 1 6 GLU n 1 7 SER n 1 8 PRO n 1 9 PHE n 1 10 ARG n 1 11 GLY n 1 12 LYS n 1 13 LEU n 1 14 LEU n 1 15 SER n 1 16 GLU n 1 17 GLN n 1 18 VAL n 1 19 SER n 1 20 ASN n 1 21 PRO n 1 22 ASN n 1 23 ILE n 1 24 ARG n 1 25 VAL n 1 26 GLY n 1 27 ARG n 1 28 TYR n 1 29 SER n 1 30 TYR n 1 31 TYR n 1 32 SER n 1 33 GLY n 1 34 TYR n 1 35 TYR n 1 36 HIS n 1 37 GLY n 1 38 HIS n 1 39 SER n 1 40 PHE n 1 41 ASP n 1 42 ASP n 1 43 CYS n 1 44 ALA n 1 45 ARG n 1 46 TYR n 1 47 LEU n 1 48 MET n 1 49 PRO n 1 50 ASP n 1 51 ARG n 1 52 ASP n 1 53 ASP n 1 54 VAL n 1 55 ASP n 1 56 LYS n 1 57 LEU n 1 58 VAL n 1 59 ILE n 1 60 GLY n 1 61 SER n 1 62 PHE n 1 63 CYS n 1 64 SER n 1 65 ILE n 1 66 GLY n 1 67 SER n 1 68 GLY n 1 69 ALA n 1 70 ALA n 1 71 PHE n 1 72 ILE n 1 73 MET n 1 74 ALA n 1 75 GLY n 1 76 ASN n 1 77 GLN n 1 78 GLY n 1 79 HIS n 1 80 ARG n 1 81 ALA n 1 82 GLU n 1 83 TRP n 1 84 ALA n 1 85 SER n 1 86 THR n 1 87 PHE n 1 88 PRO n 1 89 PHE n 1 90 HIS n 1 91 PHE n 1 92 MET n 1 93 HIS n 1 94 GLU n 1 95 GLU n 1 96 PRO n 1 97 ALA n 1 98 PHE n 1 99 ALA n 1 100 GLY n 1 101 ALA n 1 102 VAL n 1 103 ASN n 1 104 GLY n 1 105 TYR n 1 106 GLN n 1 107 PRO n 1 108 ALA n 1 109 GLY n 1 110 ASP n 1 111 THR n 1 112 LEU n 1 113 ILE n 1 114 GLY n 1 115 HIS n 1 116 GLU n 1 117 VAL n 1 118 TRP n 1 119 ILE n 1 120 GLY n 1 121 THR n 1 122 GLU n 1 123 ALA n 1 124 MET n 1 125 PHE n 1 126 MET n 1 127 PRO n 1 128 GLY n 1 129 VAL n 1 130 ARG n 1 131 VAL n 1 132 GLY n 1 133 HIS n 1 134 GLY n 1 135 ALA n 1 136 ILE n 1 137 ILE n 1 138 GLY n 1 139 SER n 1 140 ARG n 1 141 ALA n 1 142 LEU n 1 143 VAL n 1 144 THR n 1 145 GLY n 1 146 ASP n 1 147 VAL n 1 148 GLU n 1 149 PRO n 1 150 TYR n 1 151 ALA n 1 152 ILE n 1 153 VAL n 1 154 GLY n 1 155 GLY n 1 156 ASN n 1 157 PRO n 1 158 ALA n 1 159 ARG n 1 160 THR n 1 161 ILE n 1 162 ARG n 1 163 LYS n 1 164 ARG n 1 165 PHE n 1 166 SER n 1 167 ASP n 1 168 GLY n 1 169 ASP n 1 170 ILE n 1 171 GLN n 1 172 ASN n 1 173 LEU n 1 174 LEU n 1 175 GLU n 1 176 MET n 1 177 ALA n 1 178 TRP n 1 179 TRP n 1 180 ASP n 1 181 TRP n 1 182 PRO n 1 183 LEU n 1 184 ALA n 1 185 ASP n 1 186 ILE n 1 187 GLU n 1 188 ALA n 1 189 ALA n 1 190 MET n 1 191 PRO n 1 192 LEU n 1 193 LEU n 1 194 CYS n 1 195 THR n 1 196 GLY n 1 197 ASP n 1 198 ILE n 1 199 PRO n 1 200 ALA n 1 201 LEU n 1 202 TYR n 1 203 GLN n 1 204 HIS n 1 205 TRP n 1 206 LYS n 1 207 GLN n 1 208 ARG n 1 209 GLN n 1 210 ALA n 1 211 THR n 1 212 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain PA103 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc 'ATCC 29260' _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET3A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PYT1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAT4_PSEAE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P26841 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MGNYFESPFRGKLLSEQVSNPNIRVGRYSYYSGYYHGHSFDDCARYLMPDRDDVDKLVIGSFCSIGSGAAFIMAGNQGHR AEWASTFPFHFMHEEPVFAGAVNGYQPAGDTLIGHDVWIGTEAMFMPGVRVGHGAIIGSRALVTGDVEPYAIVGGNPART IRKRFSDGDIQNLLEMAWWDWPLADIEAAMPLLCTGDIPALYRHWKQRQATA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XAT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 212 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26841 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 212 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 212 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1XAT ALA A 97 ? UNP P26841 VAL 97 CONFLICT 97 1 1 1XAT GLU A 116 ? UNP P26841 ASP 116 CONFLICT 116 2 1 1XAT GLN A 203 ? UNP P26841 ARG 203 CONFLICT 203 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1XAT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 6.6 _exptl_crystal.density_percent_sol 79. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '10-20% POLYETHYLENEGLYCOL MONOMETHYL ETHER 2000, 100 MM TRIS, PH 8.5, 10 MM NICL2' # _diffrn.id 1 _diffrn.ambient_temp 295 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type SIEMENS _diffrn_detector.pdbx_collection_date 1997-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1XAT _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 99.0 _reflns.d_resolution_high 3.2 _reflns.number_obs 10448 _reflns.number_all ? _reflns.percent_possible_obs 95.1 _reflns.pdbx_Rmerge_I_obs 0.0780000 _reflns.pdbx_Rsym_value 0.0780000 _reflns.pdbx_netI_over_sigmaI 13.6 _reflns.B_iso_Wilson_estimate 24.8 _reflns.pdbx_redundancy 3.2 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.20 _reflns_shell.d_res_low 3.30 _reflns_shell.percent_possible_all 91.1 _reflns_shell.Rmerge_I_obs 0.1650000 _reflns_shell.pdbx_Rsym_value 0.1650000 _reflns_shell.meanI_over_sigI_obs 8.0 _reflns_shell.pdbx_redundancy 2.9 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1XAT _refine.ls_number_reflns_obs 9685 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.00100 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.00 _refine.ls_d_res_high 3.20 _refine.ls_percent_reflns_obs 95.1 _refine.ls_R_factor_obs 0.2210000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2210000 _refine.ls_R_factor_R_free 0.2590000 _refine.ls_R_factor_R_free_error 0.011 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.3 _refine.ls_number_reflns_R_free 510 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 21.7 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_isotropic_thermal_model GROUP _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1XAT _refine_analyze.Luzzati_coordinate_error_obs 0.33 _refine_analyze.Luzzati_sigma_a_obs 0.17 _refine_analyze.Luzzati_d_res_low_obs 8.00 _refine_analyze.Luzzati_coordinate_error_free 0.40 _refine_analyze.Luzzati_sigma_a_free 0.12 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1572 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1572 _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 8.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 27.1 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 0.64 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 3.20 _refine_ls_shell.d_res_low 3.39 _refine_ls_shell.number_reflns_R_work 1393 _refine_ls_shell.R_factor_R_work 0.2640000 _refine_ls_shell.percent_reflns_obs 87.3 _refine_ls_shell.R_factor_R_free 0.2770000 _refine_ls_shell.R_factor_R_free_error 0.034 _refine_ls_shell.percent_reflns_R_free 4.5 _refine_ls_shell.number_reflns_R_free 66 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 1XAT _struct.title 'STRUCTURE OF THE HEXAPEPTIDE XENOBIOTIC ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA' _struct.pdbx_descriptor 'XENOBIOTIC ACETYLTRANSFERASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XAT _struct_keywords.pdbx_keywords ACETYLTRANSFERASE _struct_keywords.text 'ACETYLTRANSFERASE, XENOBIOTIC, CHLORAMPHENICOL, LEFT-HANDED BETA HELIX' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 40 ? CYS A 43 ? PHE A 40 CYS A 43 5 ? 4 HELX_P HELX_P2 2 PHE A 89 ? PHE A 91 ? PHE A 89 PHE A 91 5 ? 3 HELX_P HELX_P3 3 PRO A 96 ? GLY A 100 ? PRO A 96 GLY A 100 5 ? 5 HELX_P HELX_P4 4 ASP A 167 ? MET A 176 ? ASP A 167 MET A 176 1 ? 10 HELX_P HELX_P5 5 TRP A 178 ? ASP A 180 ? TRP A 178 ASP A 180 5 ? 3 HELX_P HELX_P6 6 LEU A 183 ? LEU A 193 ? LEU A 183 LEU A 193 1 ? 11 HELX_P HELX_P7 7 ILE A 198 ? ARG A 208 ? ILE A 198 ARG A 208 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 156 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 156 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 157 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 157 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.22 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 23 ? VAL A 25 ? ILE A 23 VAL A 25 A 2 LEU A 57 ? ILE A 59 ? LEU A 57 ILE A 59 A 3 THR A 111 ? ILE A 113 ? THR A 111 ILE A 113 B 1 ALA A 151 ? GLY A 154 ? ALA A 151 GLY A 154 B 2 ARG A 159 ? LYS A 163 ? ARG A 159 LYS A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 24 ? O ARG A 24 N LEU A 57 ? N LEU A 57 A 2 3 O VAL A 58 ? O VAL A 58 N THR A 111 ? N THR A 111 B 1 2 O ILE A 152 ? O ILE A 152 N ARG A 162 ? N ARG A 162 # _database_PDB_matrix.entry_id 1XAT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XAT _atom_sites.fract_transf_matrix[1][1] 0.006460 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006460 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006460 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 TRP 118 118 118 TRP TRP A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 GLN 171 171 171 GLN GLN A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 MET 176 176 176 MET MET A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 TRP 178 178 178 TRP TRP A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 TRP 181 181 181 TRP TRP A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 MET 190 190 190 MET MET A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 CYS 194 194 194 CYS CYS A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 TRP 205 205 205 TRP TRP A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 THR 211 211 ? ? ? A . n A 1 212 ALA 212 212 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8600 ? 1 MORE -52 ? 1 'SSA (A^2)' 24030 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-06-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHASES phasing . ? 1 X-PLOR 'model building' 3.851 ? 2 X-PLOR refinement 3.851 ? 3 XENGEN 'data reduction' . ? 4 XENGEN 'data scaling' . ? 5 X-PLOR phasing 3.851 ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 17 ? ? -152.03 -19.08 2 1 SER A 19 ? ? -147.88 -26.04 3 1 TYR A 28 ? ? 66.07 -12.92 4 1 MET A 73 ? ? -117.16 -167.94 5 1 ALA A 74 ? ? 70.64 34.36 6 1 HIS A 93 ? ? -38.36 -75.26 7 1 GLU A 94 ? ? -24.45 -65.91 8 1 GLU A 95 ? ? -51.17 108.00 9 1 GLU A 122 ? ? 58.73 17.33 10 1 ALA A 135 ? ? -46.05 151.51 11 1 ARG A 140 ? ? 58.30 2.34 12 1 ARG A 162 ? ? 164.11 166.31 13 1 ALA A 177 ? ? 33.23 67.17 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 10 ? CG ? A ARG 10 CG 2 1 Y 1 A ARG 10 ? CD ? A ARG 10 CD 3 1 Y 1 A ARG 10 ? NE ? A ARG 10 NE 4 1 Y 1 A ARG 10 ? CZ ? A ARG 10 CZ 5 1 Y 1 A ARG 10 ? NH1 ? A ARG 10 NH1 6 1 Y 1 A ARG 10 ? NH2 ? A ARG 10 NH2 7 1 Y 1 A GLU 16 ? CG ? A GLU 16 CG 8 1 Y 1 A GLU 16 ? CD ? A GLU 16 CD 9 1 Y 1 A GLU 16 ? OE1 ? A GLU 16 OE1 10 1 Y 1 A GLU 16 ? OE2 ? A GLU 16 OE2 11 1 Y 1 A ARG 24 ? CG ? A ARG 24 CG 12 1 Y 1 A ARG 24 ? CD ? A ARG 24 CD 13 1 Y 1 A ARG 24 ? NE ? A ARG 24 NE 14 1 Y 1 A ARG 24 ? CZ ? A ARG 24 CZ 15 1 Y 1 A ARG 24 ? NH1 ? A ARG 24 NH1 16 1 Y 1 A ARG 24 ? NH2 ? A ARG 24 NH2 17 1 Y 1 A ASP 50 ? CG ? A ASP 50 CG 18 1 Y 1 A ASP 50 ? OD1 ? A ASP 50 OD1 19 1 Y 1 A ASP 50 ? OD2 ? A ASP 50 OD2 20 1 Y 1 A ARG 51 ? CG ? A ARG 51 CG 21 1 Y 1 A ARG 51 ? CD ? A ARG 51 CD 22 1 Y 1 A ARG 51 ? NE ? A ARG 51 NE 23 1 Y 1 A ARG 51 ? CZ ? A ARG 51 CZ 24 1 Y 1 A ARG 51 ? NH1 ? A ARG 51 NH1 25 1 Y 1 A ARG 51 ? NH2 ? A ARG 51 NH2 26 1 Y 1 A ASP 52 ? CG ? A ASP 52 CG 27 1 Y 1 A ASP 52 ? OD1 ? A ASP 52 OD1 28 1 Y 1 A ASP 52 ? OD2 ? A ASP 52 OD2 29 1 Y 1 A ASP 53 ? CG ? A ASP 53 CG 30 1 Y 1 A ASP 53 ? OD1 ? A ASP 53 OD1 31 1 Y 1 A ASP 53 ? OD2 ? A ASP 53 OD2 32 1 Y 1 A SER 61 ? OG ? A SER 61 OG 33 1 Y 1 A MET 92 ? CG ? A MET 92 CG 34 1 Y 1 A MET 92 ? SD ? A MET 92 SD 35 1 Y 1 A MET 92 ? CE ? A MET 92 CE 36 1 Y 1 A HIS 93 ? CG ? A HIS 93 CG 37 1 Y 1 A HIS 93 ? ND1 ? A HIS 93 ND1 38 1 Y 1 A HIS 93 ? CD2 ? A HIS 93 CD2 39 1 Y 1 A HIS 93 ? CE1 ? A HIS 93 CE1 40 1 Y 1 A HIS 93 ? NE2 ? A HIS 93 NE2 41 1 Y 1 A GLU 94 ? CG ? A GLU 94 CG 42 1 Y 1 A GLU 94 ? CD ? A GLU 94 CD 43 1 Y 1 A GLU 94 ? OE1 ? A GLU 94 OE1 44 1 Y 1 A GLU 94 ? OE2 ? A GLU 94 OE2 45 1 Y 1 A GLN 171 ? CG ? A GLN 171 CG 46 1 Y 1 A GLN 171 ? CD ? A GLN 171 CD 47 1 Y 1 A GLN 171 ? OE1 ? A GLN 171 OE1 48 1 Y 1 A GLN 171 ? NE2 ? A GLN 171 NE2 49 1 Y 1 A GLU 175 ? CG ? A GLU 175 CG 50 1 Y 1 A GLU 175 ? CD ? A GLU 175 CD 51 1 Y 1 A GLU 175 ? OE1 ? A GLU 175 OE1 52 1 Y 1 A GLU 175 ? OE2 ? A GLU 175 OE2 53 1 Y 1 A LYS 206 ? CG ? A LYS 206 CG 54 1 Y 1 A LYS 206 ? CD ? A LYS 206 CD 55 1 Y 1 A LYS 206 ? CE ? A LYS 206 CE 56 1 Y 1 A LYS 206 ? NZ ? A LYS 206 NZ 57 1 Y 1 A GLN 209 ? CG ? A GLN 209 CG 58 1 Y 1 A GLN 209 ? CD ? A GLN 209 CD 59 1 Y 1 A GLN 209 ? OE1 ? A GLN 209 OE1 60 1 Y 1 A GLN 209 ? NE2 ? A GLN 209 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A THR 211 ? A THR 211 4 1 Y 1 A ALA 212 ? A ALA 212 #