data_1XDU # _entry.id 1XDU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1XDU RCSB RCSB030248 WWPDB D_1000030248 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1QZZ 'Crystal structure of aclacinomycin-10-hydroxylase (RdmB) in complex with S-adenosyl-L-methionine (SAM)' unspecified PDB 1R00 'Crystal structure of aclacinomycin-10-hydroxylase (RdmB) in complex with S-adenosyl-L-homocystein (SAH)' unspecified PDB 1TW3 ;Crystal structure of carminomycin-4-O-methyltransferase (DnrK) in complex with S-adenosyl-L-homocystein (SAH) and epsilon-rhodomycin T (ET) ; unspecified PDB 1XDS . unspecified # _pdbx_database_status.entry_id 1XDU _pdbx_database_status.status_code REL _pdbx_database_status.recvd_initial_deposition_date 2004-09-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry N _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jansson, A.' 1 'Koskiniemi, H.' 2 'Erola, A.' 3 'Wang, J.' 4 'Mantsala, P.' 5 'Schneider, G.' 6 'Niemi, J.' 7 # _citation.id primary _citation.title 'Aclacinomycin 10-Hydroxylase Is a Novel Substrate-assisted Hydroxylase Requiring S-Adenosyl-L-methionine as Cofactor' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 3636 _citation.page_last 3644 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15548527 _citation.pdbx_database_id_DOI 10.1074/jbc.M412095200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Jansson, A.' 1 primary 'Koskiniemi, H.' 2 primary 'Erola, A.' 3 primary 'Wang, J.' 4 primary 'Schneider, G.' 5 primary 'Niemi, J.' 6 # _cell.entry_id 1XDU _cell.length_a 62.758 _cell.length_b 86.813 _cell.length_c 117.395 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XDU _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.cell_setting orthorhombic _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein RdmB' 40166.207 1 ? ? ? ? 2 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 3 non-polymer syn SINEFUNGIN 381.387 1 ? ? ? ? 4 water nat water 18.015 26 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SSSSPGEPLEPTDQDLDVLLKNLGNLVTP(MSE)ALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRH LTVVGVLEGGEKQGRPLRPTRLG(MSE)LLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWED LSADVALADSFDAL(MSE)SCDEDLAYEAPADAYDWSAVRHVLDVGGGNGG(MSE)LAAIALRAPHLRGTLVELAGPAER ARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFF STLLDLR(MSE)LTF(MSE)GGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVSEEAAPAAQASEALPA QE ; _entity_poly.pdbx_seq_one_letter_code_can ;MSSSSPGEPLEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLE GGEKQGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFD ALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGD FFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFFSTLLDLRMLTFMGGRVRTRD EVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVSEEAAPAAQASEALPAQE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 SER n 1 4 SER n 1 5 SER n 1 6 PRO n 1 7 GLY n 1 8 GLU n 1 9 PRO n 1 10 LEU n 1 11 GLU n 1 12 PRO n 1 13 THR n 1 14 ASP n 1 15 GLN n 1 16 ASP n 1 17 LEU n 1 18 ASP n 1 19 VAL n 1 20 LEU n 1 21 LEU n 1 22 LYS n 1 23 ASN n 1 24 LEU n 1 25 GLY n 1 26 ASN n 1 27 LEU n 1 28 VAL n 1 29 THR n 1 30 PRO n 1 31 MSE n 1 32 ALA n 1 33 LEU n 1 34 ARG n 1 35 VAL n 1 36 ALA n 1 37 ALA n 1 38 THR n 1 39 LEU n 1 40 ARG n 1 41 LEU n 1 42 VAL n 1 43 ASP n 1 44 HIS n 1 45 LEU n 1 46 LEU n 1 47 ALA n 1 48 GLY n 1 49 ALA n 1 50 ASP n 1 51 THR n 1 52 LEU n 1 53 ALA n 1 54 GLY n 1 55 LEU n 1 56 ALA n 1 57 ASP n 1 58 ARG n 1 59 THR n 1 60 ASP n 1 61 THR n 1 62 HIS n 1 63 PRO n 1 64 GLN n 1 65 ALA n 1 66 LEU n 1 67 SER n 1 68 ARG n 1 69 LEU n 1 70 VAL n 1 71 ARG n 1 72 HIS n 1 73 LEU n 1 74 THR n 1 75 VAL n 1 76 VAL n 1 77 GLY n 1 78 VAL n 1 79 LEU n 1 80 GLU n 1 81 GLY n 1 82 GLY n 1 83 GLU n 1 84 LYS n 1 85 GLN n 1 86 GLY n 1 87 ARG n 1 88 PRO n 1 89 LEU n 1 90 ARG n 1 91 PRO n 1 92 THR n 1 93 ARG n 1 94 LEU n 1 95 GLY n 1 96 MSE n 1 97 LEU n 1 98 LEU n 1 99 ALA n 1 100 ASP n 1 101 GLY n 1 102 HIS n 1 103 PRO n 1 104 ALA n 1 105 GLN n 1 106 GLN n 1 107 ARG n 1 108 ALA n 1 109 TRP n 1 110 LEU n 1 111 ASP n 1 112 LEU n 1 113 ASN n 1 114 GLY n 1 115 ALA n 1 116 VAL n 1 117 SER n 1 118 HIS n 1 119 ALA n 1 120 ASP n 1 121 LEU n 1 122 ALA n 1 123 PHE n 1 124 THR n 1 125 GLY n 1 126 LEU n 1 127 LEU n 1 128 ASP n 1 129 VAL n 1 130 VAL n 1 131 ARG n 1 132 THR n 1 133 GLY n 1 134 ARG n 1 135 PRO n 1 136 ALA n 1 137 TYR n 1 138 ALA n 1 139 GLY n 1 140 ARG n 1 141 TYR n 1 142 GLY n 1 143 ARG n 1 144 PRO n 1 145 PHE n 1 146 TRP n 1 147 GLU n 1 148 ASP n 1 149 LEU n 1 150 SER n 1 151 ALA n 1 152 ASP n 1 153 VAL n 1 154 ALA n 1 155 LEU n 1 156 ALA n 1 157 ASP n 1 158 SER n 1 159 PHE n 1 160 ASP n 1 161 ALA n 1 162 LEU n 1 163 MSE n 1 164 SER n 1 165 CYS n 1 166 ASP n 1 167 GLU n 1 168 ASP n 1 169 LEU n 1 170 ALA n 1 171 TYR n 1 172 GLU n 1 173 ALA n 1 174 PRO n 1 175 ALA n 1 176 ASP n 1 177 ALA n 1 178 TYR n 1 179 ASP n 1 180 TRP n 1 181 SER n 1 182 ALA n 1 183 VAL n 1 184 ARG n 1 185 HIS n 1 186 VAL n 1 187 LEU n 1 188 ASP n 1 189 VAL n 1 190 GLY n 1 191 GLY n 1 192 GLY n 1 193 ASN n 1 194 GLY n 1 195 GLY n 1 196 MSE n 1 197 LEU n 1 198 ALA n 1 199 ALA n 1 200 ILE n 1 201 ALA n 1 202 LEU n 1 203 ARG n 1 204 ALA n 1 205 PRO n 1 206 HIS n 1 207 LEU n 1 208 ARG n 1 209 GLY n 1 210 THR n 1 211 LEU n 1 212 VAL n 1 213 GLU n 1 214 LEU n 1 215 ALA n 1 216 GLY n 1 217 PRO n 1 218 ALA n 1 219 GLU n 1 220 ARG n 1 221 ALA n 1 222 ARG n 1 223 ARG n 1 224 ARG n 1 225 PHE n 1 226 ALA n 1 227 ASP n 1 228 ALA n 1 229 GLY n 1 230 LEU n 1 231 ALA n 1 232 ASP n 1 233 ARG n 1 234 VAL n 1 235 THR n 1 236 VAL n 1 237 ALA n 1 238 GLU n 1 239 GLY n 1 240 ASP n 1 241 PHE n 1 242 PHE n 1 243 LYS n 1 244 PRO n 1 245 LEU n 1 246 PRO n 1 247 VAL n 1 248 THR n 1 249 ALA n 1 250 ASP n 1 251 VAL n 1 252 VAL n 1 253 LEU n 1 254 LEU n 1 255 SER n 1 256 PHE n 1 257 VAL n 1 258 LEU n 1 259 LEU n 1 260 ASN n 1 261 TRP n 1 262 SER n 1 263 ASP n 1 264 GLU n 1 265 ASP n 1 266 ALA n 1 267 LEU n 1 268 THR n 1 269 ILE n 1 270 LEU n 1 271 ARG n 1 272 GLY n 1 273 CYS n 1 274 VAL n 1 275 ARG n 1 276 ALA n 1 277 LEU n 1 278 GLU n 1 279 PRO n 1 280 GLY n 1 281 GLY n 1 282 ARG n 1 283 LEU n 1 284 LEU n 1 285 VAL n 1 286 LEU n 1 287 ASP n 1 288 ARG n 1 289 ALA n 1 290 ASP n 1 291 VAL n 1 292 GLU n 1 293 GLY n 1 294 ASP n 1 295 GLY n 1 296 ALA n 1 297 ASP n 1 298 ARG n 1 299 PHE n 1 300 PHE n 1 301 SER n 1 302 THR n 1 303 LEU n 1 304 LEU n 1 305 ASP n 1 306 LEU n 1 307 ARG n 1 308 MSE n 1 309 LEU n 1 310 THR n 1 311 PHE n 1 312 MSE n 1 313 GLY n 1 314 GLY n 1 315 ARG n 1 316 VAL n 1 317 ARG n 1 318 THR n 1 319 ARG n 1 320 ASP n 1 321 GLU n 1 322 VAL n 1 323 VAL n 1 324 ASP n 1 325 LEU n 1 326 ALA n 1 327 GLY n 1 328 SER n 1 329 ALA n 1 330 GLY n 1 331 LEU n 1 332 ALA n 1 333 LEU n 1 334 ALA n 1 335 SER n 1 336 GLU n 1 337 ARG n 1 338 THR n 1 339 SER n 1 340 GLY n 1 341 SER n 1 342 THR n 1 343 THR n 1 344 LEU n 1 345 PRO n 1 346 PHE n 1 347 ASP n 1 348 PHE n 1 349 SER n 1 350 ILE n 1 351 LEU n 1 352 GLU n 1 353 PHE n 1 354 THR n 1 355 ALA n 1 356 VAL n 1 357 SER n 1 358 GLU n 1 359 GLU n 1 360 ALA n 1 361 ALA n 1 362 PRO n 1 363 ALA n 1 364 ALA n 1 365 GLN n 1 366 ALA n 1 367 SER n 1 368 GLU n 1 369 ALA n 1 370 LEU n 1 371 PRO n 1 372 ALA n 1 373 GLN n 1 374 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptomyces _entity_src_gen.pdbx_gene_src_gene rdmb _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces purpurascens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1924 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pRDM16 from pGEX4T-3' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.db_name UNP _struct_ref.db_code Q54527_9ACTO _struct_ref.pdbx_db_accession Q54527 _struct_ref.pdbx_seq_one_letter_code ;MSSSSPGEPLEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLE GGEKQGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFD ALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGD FFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADVEGDGADRFFSTLLDLRMLTFMGGRVRTRD EVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVSEEAAPAAQASEALPAQE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XDU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 374 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q54527 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 374 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 374 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1XDU MSE A 1 ? UNP Q54527 MET 1 'MODIFIED RESIDUE' 1 1 1 1XDU MSE A 31 ? UNP Q54527 MET 31 'MODIFIED RESIDUE' 31 2 1 1XDU MSE A 96 ? UNP Q54527 MET 96 'MODIFIED RESIDUE' 96 3 1 1XDU MSE A 163 ? UNP Q54527 MET 163 'MODIFIED RESIDUE' 163 4 1 1XDU MSE A 196 ? UNP Q54527 MET 196 'MODIFIED RESIDUE' 196 5 1 1XDU MSE A 308 ? UNP Q54527 MET 308 'MODIFIED RESIDUE' 308 6 1 1XDU MSE A 312 ? UNP Q54527 MET 312 'MODIFIED RESIDUE' 312 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SFG non-polymer . SINEFUNGIN ADENOSYL-ORNITHINE 'C15 H23 N7 O5' 381.387 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1XDU _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_percent_sol 43.7 _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_meas ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 294 _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details 'ammonium acetate, PEG 4000, sodium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 294K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2003-11-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0500 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0500 # _reflns.entry_id 1XDU _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.70 _reflns.d_resolution_low 58.7 _reflns.number_all 8940 _reflns.number_obs 8940 _reflns.percent_possible_obs 98.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.104 _reflns.pdbx_netI_over_sigmaI 12.2 _reflns.B_iso_Wilson_estimate 40 _reflns.pdbx_redundancy 9.82 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.83 _reflns_shell.percent_possible_all 99.5 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.252 _reflns_shell.meanI_over_sigI_obs 4.6 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1XDU _refine.ls_number_reflns_obs 8521 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 58.72 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 97.99 _refine.ls_R_factor_obs 0.23059 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.22742 _refine.ls_R_factor_R_free 0.29513 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 419 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.912 _refine.correlation_coeff_Fo_to_Fc_free 0.854 _refine.B_iso_mean 32.176 _refine.aniso_B[1][1] -1.42 _refine.aniso_B[2][2] 2.08 _refine.aniso_B[3][3] -0.66 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'RdmB+SAM complex' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model 'Isotropic B-factors for each atom' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.451 _refine.overall_SU_ML 0.343 _refine.overall_SU_B 16.587 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2570 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 2627 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 58.72 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.007 0.021 ? 2631 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 2497 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.201 1.988 ? 3580 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.818 3.000 ? 5719 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.616 5.000 ? 337 'X-RAY DIFFRACTION' ? r_chiral_restr 0.059 0.200 ? 422 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.003 0.020 ? 2975 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.003 0.020 ? 562 'X-RAY DIFFRACTION' ? r_nbd_refined 0.204 0.200 ? 619 'X-RAY DIFFRACTION' ? r_nbd_other 0.226 0.200 ? 2829 'X-RAY DIFFRACTION' ? r_nbtor_other 0.081 0.200 ? 1599 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.148 0.200 ? 42 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.215 0.200 ? 28 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.263 0.200 ? 128 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.190 0.200 ? 7 'X-RAY DIFFRACTION' ? r_mcbond_it 0.511 1.500 ? 1689 'X-RAY DIFFRACTION' ? r_mcangle_it 0.973 2.000 ? 2676 'X-RAY DIFFRACTION' ? r_scbond_it 0.989 3.000 ? 942 'X-RAY DIFFRACTION' ? r_scangle_it 1.852 4.500 ? 904 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.700 _refine_ls_shell.d_res_low 2.770 _refine_ls_shell.number_reflns_R_work 614 _refine_ls_shell.R_factor_R_work 0.264 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.426 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 30 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1XDU _struct.title 'Crystal structure of Aclacinomycin-10-hydroxylase (RdmB) in complex with Sinefungin (SFG)' _struct.pdbx_descriptor 'Protein RdmB' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XDU _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;Anthracycline; hydroxylase; S-adenosyl-L-methionine analogue; sinefungin; streptomyces; polyketide antibiotics; divergent evolution, transferase ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 13 ? ASN A 23 ? THR A 13 ASN A 23 1 ? 11 HELX_P HELX_P2 2 LEU A 27 ? LEU A 39 ? LEU A 27 LEU A 39 1 ? 13 HELX_P HELX_P3 3 ARG A 40 ? ALA A 47 ? ARG A 40 ALA A 47 1 ? 8 HELX_P HELX_P4 4 THR A 51 ? ARG A 58 ? THR A 51 ARG A 58 1 ? 8 HELX_P HELX_P5 5 HIS A 62 ? VAL A 76 ? HIS A 62 VAL A 76 1 ? 15 HELX_P HELX_P6 6 ARG A 93 ? ALA A 99 ? ARG A 93 ALA A 99 5 ? 7 HELX_P HELX_P7 7 GLN A 105 ? ASP A 111 ? GLN A 105 ASP A 111 1 ? 7 HELX_P HELX_P8 8 GLY A 114 ? LEU A 121 ? GLY A 114 LEU A 121 1 ? 8 HELX_P HELX_P9 9 ALA A 122 ? THR A 124 ? ALA A 122 THR A 124 5 ? 3 HELX_P HELX_P10 10 GLY A 125 ? GLY A 133 ? GLY A 125 GLY A 133 1 ? 9 HELX_P HELX_P11 11 ALA A 136 ? GLY A 142 ? ALA A 136 GLY A 142 1 ? 7 HELX_P HELX_P12 12 PRO A 144 ? ASP A 152 ? PRO A 144 ASP A 152 1 ? 9 HELX_P HELX_P13 13 ASP A 152 ? LEU A 162 ? ASP A 152 LEU A 162 1 ? 11 HELX_P HELX_P14 14 MSE A 163 ? GLU A 167 ? MSE A 163 GLU A 167 5 ? 5 HELX_P HELX_P15 15 TYR A 171 ? TYR A 178 ? TYR A 171 TYR A 178 1 ? 8 HELX_P HELX_P16 16 GLY A 194 ? ALA A 204 ? GLY A 194 ALA A 204 1 ? 11 HELX_P HELX_P17 17 LEU A 214 ? ALA A 228 ? LEU A 214 ALA A 228 1 ? 15 HELX_P HELX_P18 18 VAL A 257 ? TRP A 261 ? VAL A 257 TRP A 261 5 ? 5 HELX_P HELX_P19 19 SER A 262 ? ALA A 276 ? SER A 262 ALA A 276 1 ? 15 HELX_P HELX_P20 20 ALA A 296 ? GLY A 313 ? ALA A 296 GLY A 313 1 ? 18 HELX_P HELX_P21 21 THR A 318 ? SER A 328 ? THR A 318 SER A 328 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A PRO 30 C ? ? ? 1_555 A MSE 31 N ? ? A PRO 30 A MSE 31 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale ? ? A MSE 31 C ? ? ? 1_555 A ALA 32 N ? ? A MSE 31 A ALA 32 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A GLY 95 C ? ? ? 1_555 A MSE 96 N ? ? A GLY 95 A MSE 96 1_555 ? ? ? ? ? ? ? 1.332 ? covale4 covale ? ? A MSE 96 C ? ? ? 1_555 A LEU 97 N ? ? A MSE 96 A LEU 97 1_555 ? ? ? ? ? ? ? 1.331 ? covale5 covale ? ? A LEU 162 C ? ? ? 1_555 A MSE 163 N ? ? A LEU 162 A MSE 163 1_555 ? ? ? ? ? ? ? 1.334 ? covale6 covale ? ? A MSE 163 C ? ? ? 1_555 A SER 164 N ? ? A MSE 163 A SER 164 1_555 ? ? ? ? ? ? ? 1.332 ? covale7 covale ? ? A GLY 195 C ? ? ? 1_555 A MSE 196 N ? ? A GLY 195 A MSE 196 1_555 ? ? ? ? ? ? ? 1.332 ? covale8 covale ? ? A MSE 196 C ? ? ? 1_555 A LEU 197 N ? ? A MSE 196 A LEU 197 1_555 ? ? ? ? ? ? ? 1.329 ? covale9 covale ? ? A ARG 307 C ? ? ? 1_555 A MSE 308 N ? ? A ARG 307 A MSE 308 1_555 ? ? ? ? ? ? ? 1.327 ? covale10 covale ? ? A MSE 308 C ? ? ? 1_555 A LEU 309 N ? ? A MSE 308 A LEU 309 1_555 ? ? ? ? ? ? ? 1.329 ? covale11 covale ? ? A PHE 311 C ? ? ? 1_555 A MSE 312 N ? ? A PHE 311 A MSE 312 1_555 ? ? ? ? ? ? ? 1.325 ? covale12 covale ? ? A MSE 312 C ? ? ? 1_555 A GLY 313 N ? ? A MSE 312 A GLY 313 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 79 ? GLU A 80 ? LEU A 79 GLU A 80 A 2 ARG A 90 ? PRO A 91 ? ARG A 90 PRO A 91 B 1 VAL A 234 ? GLU A 238 ? VAL A 234 GLU A 238 B 2 ARG A 208 ? GLU A 213 ? ARG A 208 GLU A 213 B 3 HIS A 185 ? VAL A 189 ? HIS A 185 VAL A 189 B 4 ALA A 249 ? SER A 255 ? ALA A 249 SER A 255 B 5 LEU A 277 ? ASP A 287 ? LEU A 277 ASP A 287 B 6 PHE A 348 ? ALA A 355 ? PHE A 348 ALA A 355 B 7 LEU A 331 ? SER A 339 ? LEU A 331 SER A 339 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 80 ? N GLU A 80 O ARG A 90 ? O ARG A 90 B 1 2 O ALA A 237 ? O ALA A 237 N LEU A 211 ? N LEU A 211 B 2 3 O THR A 210 ? O THR A 210 N ASP A 188 ? N ASP A 188 B 3 4 N LEU A 187 ? N LEU A 187 O LEU A 253 ? O LEU A 253 B 4 5 N ALA A 249 ? N ALA A 249 O GLU A 278 ? O GLU A 278 B 5 6 N LEU A 283 ? N LEU A 283 O PHE A 353 ? O PHE A 353 B 6 7 O GLU A 352 ? O GLU A 352 N ALA A 334 ? N ALA A 334 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ACT A 421' AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE SFG A 5635' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 VAL A 236 ? VAL A 236 . ? 5_545 ? 2 AC1 2 HOH D . ? HOH A 5661 . ? 5_545 ? 3 AC2 16 TRP A 146 ? TRP A 146 . ? 1_555 ? 4 AC2 16 TYR A 171 ? TYR A 171 . ? 1_555 ? 5 AC2 16 GLY A 190 ? GLY A 190 . ? 1_555 ? 6 AC2 16 GLY A 191 ? GLY A 191 . ? 1_555 ? 7 AC2 16 GLY A 192 ? GLY A 192 . ? 1_555 ? 8 AC2 16 GLU A 213 ? GLU A 213 . ? 1_555 ? 9 AC2 16 LEU A 214 ? LEU A 214 . ? 1_555 ? 10 AC2 16 PRO A 217 ? PRO A 217 . ? 1_555 ? 11 AC2 16 GLY A 239 ? GLY A 239 . ? 1_555 ? 12 AC2 16 ASP A 240 ? ASP A 240 . ? 1_555 ? 13 AC2 16 PHE A 241 ? PHE A 241 . ? 1_555 ? 14 AC2 16 PHE A 242 ? PHE A 242 . ? 1_555 ? 15 AC2 16 SER A 255 ? SER A 255 . ? 1_555 ? 16 AC2 16 PHE A 256 ? PHE A 256 . ? 1_555 ? 17 AC2 16 ASN A 260 ? ASN A 260 . ? 1_555 ? 18 AC2 16 TRP A 261 ? TRP A 261 . ? 1_555 ? # _atom_sites.entry_id 1XDU _atom_sites.fract_transf_matrix[1][1] 0.015934 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011519 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008518 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 MSE 31 31 31 MSE MSE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLN 85 85 ? ? ? A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 MSE 96 96 96 MSE MSE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 TRP 146 146 146 TRP TRP A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 MSE 163 163 163 MSE MSE A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 CYS 165 165 165 CYS CYS A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 TYR 171 171 171 TYR TYR A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 TRP 180 180 180 TRP TRP A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 HIS 185 185 185 HIS HIS A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 MSE 196 196 196 MSE MSE A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 HIS 206 206 206 HIS HIS A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 ARG 224 224 224 ARG ARG A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 ASP 232 232 232 ASP ASP A . n A 1 233 ARG 233 233 233 ARG ARG A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 PHE 241 241 241 PHE PHE A . n A 1 242 PHE 242 242 242 PHE PHE A . n A 1 243 LYS 243 243 243 LYS LYS A . n A 1 244 PRO 244 244 244 PRO PRO A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 PRO 246 246 246 PRO PRO A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 THR 248 248 248 THR THR A . n A 1 249 ALA 249 249 249 ALA ALA A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 VAL 252 252 252 VAL VAL A . n A 1 253 LEU 253 253 253 LEU LEU A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 SER 255 255 255 SER SER A . n A 1 256 PHE 256 256 256 PHE PHE A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 ASN 260 260 260 ASN ASN A . n A 1 261 TRP 261 261 261 TRP TRP A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 ASP 263 263 263 ASP ASP A . n A 1 264 GLU 264 264 264 GLU GLU A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 ALA 266 266 266 ALA ALA A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 THR 268 268 268 THR THR A . n A 1 269 ILE 269 269 269 ILE ILE A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 ARG 271 271 271 ARG ARG A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 CYS 273 273 273 CYS CYS A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 GLU 278 278 278 GLU GLU A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 GLY 281 281 281 GLY GLY A . n A 1 282 ARG 282 282 282 ARG ARG A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 VAL 285 285 285 VAL VAL A . n A 1 286 LEU 286 286 286 LEU LEU A . n A 1 287 ASP 287 287 287 ASP ASP A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 ALA 289 289 ? ? ? A . n A 1 290 ASP 290 290 ? ? ? A . n A 1 291 VAL 291 291 ? ? ? A . n A 1 292 GLU 292 292 ? ? ? A . n A 1 293 GLY 293 293 ? ? ? A . n A 1 294 ASP 294 294 ? ? ? A . n A 1 295 GLY 295 295 ? ? ? A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 ARG 298 298 298 ARG ARG A . n A 1 299 PHE 299 299 299 PHE PHE A . n A 1 300 PHE 300 300 300 PHE PHE A . n A 1 301 SER 301 301 301 SER SER A . n A 1 302 THR 302 302 302 THR THR A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 LEU 304 304 304 LEU LEU A . n A 1 305 ASP 305 305 305 ASP ASP A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 ARG 307 307 307 ARG ARG A . n A 1 308 MSE 308 308 308 MSE MSE A . n A 1 309 LEU 309 309 309 LEU LEU A . n A 1 310 THR 310 310 310 THR THR A . n A 1 311 PHE 311 311 311 PHE PHE A . n A 1 312 MSE 312 312 312 MSE MSE A . n A 1 313 GLY 313 313 313 GLY GLY A . n A 1 314 GLY 314 314 314 GLY GLY A . n A 1 315 ARG 315 315 315 ARG ARG A . n A 1 316 VAL 316 316 316 VAL VAL A . n A 1 317 ARG 317 317 317 ARG ARG A . n A 1 318 THR 318 318 318 THR THR A . n A 1 319 ARG 319 319 319 ARG ARG A . n A 1 320 ASP 320 320 320 ASP ASP A . n A 1 321 GLU 321 321 321 GLU GLU A . n A 1 322 VAL 322 322 322 VAL VAL A . n A 1 323 VAL 323 323 323 VAL VAL A . n A 1 324 ASP 324 324 324 ASP ASP A . n A 1 325 LEU 325 325 325 LEU LEU A . n A 1 326 ALA 326 326 326 ALA ALA A . n A 1 327 GLY 327 327 327 GLY GLY A . n A 1 328 SER 328 328 328 SER SER A . n A 1 329 ALA 329 329 329 ALA ALA A . n A 1 330 GLY 330 330 330 GLY GLY A . n A 1 331 LEU 331 331 331 LEU LEU A . n A 1 332 ALA 332 332 332 ALA ALA A . n A 1 333 LEU 333 333 333 LEU LEU A . n A 1 334 ALA 334 334 334 ALA ALA A . n A 1 335 SER 335 335 335 SER SER A . n A 1 336 GLU 336 336 336 GLU GLU A . n A 1 337 ARG 337 337 337 ARG ARG A . n A 1 338 THR 338 338 338 THR THR A . n A 1 339 SER 339 339 339 SER SER A . n A 1 340 GLY 340 340 340 GLY GLY A . n A 1 341 SER 341 341 341 SER SER A . n A 1 342 THR 342 342 342 THR THR A . n A 1 343 THR 343 343 343 THR THR A . n A 1 344 LEU 344 344 344 LEU LEU A . n A 1 345 PRO 345 345 345 PRO PRO A . n A 1 346 PHE 346 346 346 PHE PHE A . n A 1 347 ASP 347 347 347 ASP ASP A . n A 1 348 PHE 348 348 348 PHE PHE A . n A 1 349 SER 349 349 349 SER SER A . n A 1 350 ILE 350 350 350 ILE ILE A . n A 1 351 LEU 351 351 351 LEU LEU A . n A 1 352 GLU 352 352 352 GLU GLU A . n A 1 353 PHE 353 353 353 PHE PHE A . n A 1 354 THR 354 354 354 THR THR A . n A 1 355 ALA 355 355 355 ALA ALA A . n A 1 356 VAL 356 356 356 VAL VAL A . n A 1 357 SER 357 357 357 SER SER A . n A 1 358 GLU 358 358 ? ? ? A . n A 1 359 GLU 359 359 ? ? ? A . n A 1 360 ALA 360 360 ? ? ? A . n A 1 361 ALA 361 361 ? ? ? A . n A 1 362 PRO 362 362 ? ? ? A . n A 1 363 ALA 363 363 ? ? ? A . n A 1 364 ALA 364 364 ? ? ? A . n A 1 365 GLN 365 365 ? ? ? A . n A 1 366 ALA 366 366 ? ? ? A . n A 1 367 SER 367 367 ? ? ? A . n A 1 368 GLU 368 368 ? ? ? A . n A 1 369 ALA 369 369 ? ? ? A . n A 1 370 LEU 370 370 ? ? ? A . n A 1 371 PRO 371 371 ? ? ? A . n A 1 372 ALA 372 372 ? ? ? A . n A 1 373 GLN 373 373 ? ? ? A . n A 1 374 GLU 374 374 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 31 A MSE 31 ? MET SELENOMETHIONINE 2 A MSE 96 A MSE 96 ? MET SELENOMETHIONINE 3 A MSE 163 A MSE 163 ? MET SELENOMETHIONINE 4 A MSE 196 A MSE 196 ? MET SELENOMETHIONINE 5 A MSE 308 A MSE 308 ? MET SELENOMETHIONINE 6 A MSE 312 A MSE 312 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 7380 ? 2 MORE -57 ? 2 'SSA (A^2)' 28910 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_655 -x+1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 62.7580000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 58.6975000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-23 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 MOLREP phasing . ? 3 REFMAC refinement 5.1.24 ? 4 CCP4 'data scaling' '(SCALA)' ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 319 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CG2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 338 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.91 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 NH1 A ARG 319 ? ? 1_555 OE1 A GLU 336 ? ? 4_566 0.95 2 1 NH1 A ARG 319 ? ? 1_555 CD A GLU 336 ? ? 4_566 1.63 3 1 CZ A ARG 319 ? ? 1_555 OE1 A GLU 336 ? ? 4_566 1.98 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASP _pdbx_validate_rmsd_angle.auth_seq_id_1 227 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CG _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASP _pdbx_validate_rmsd_angle.auth_seq_id_2 227 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 OD2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASP _pdbx_validate_rmsd_angle.auth_seq_id_3 227 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 124.22 _pdbx_validate_rmsd_angle.angle_target_value 118.30 _pdbx_validate_rmsd_angle.angle_deviation 5.92 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 23 ? ? -130.51 -83.50 2 1 ASP A 50 ? ? -154.20 -30.23 3 1 GLU A 83 ? ? -15.70 -56.20 4 1 PHE A 145 ? ? -29.90 -64.88 5 1 ASP A 287 ? ? -173.02 -152.94 6 1 SER A 339 ? ? -170.39 149.86 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A GLU 8 ? A GLU 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A GLN 85 ? A GLN 85 11 1 Y 1 A ALA 289 ? A ALA 289 12 1 Y 1 A ASP 290 ? A ASP 290 13 1 Y 1 A VAL 291 ? A VAL 291 14 1 Y 1 A GLU 292 ? A GLU 292 15 1 Y 1 A GLY 293 ? A GLY 293 16 1 Y 1 A ASP 294 ? A ASP 294 17 1 Y 1 A GLY 295 ? A GLY 295 18 1 Y 1 A GLU 358 ? A GLU 358 19 1 Y 1 A GLU 359 ? A GLU 359 20 1 Y 1 A ALA 360 ? A ALA 360 21 1 Y 1 A ALA 361 ? A ALA 361 22 1 Y 1 A PRO 362 ? A PRO 362 23 1 Y 1 A ALA 363 ? A ALA 363 24 1 Y 1 A ALA 364 ? A ALA 364 25 1 Y 1 A GLN 365 ? A GLN 365 26 1 Y 1 A ALA 366 ? A ALA 366 27 1 Y 1 A SER 367 ? A SER 367 28 1 Y 1 A GLU 368 ? A GLU 368 29 1 Y 1 A ALA 369 ? A ALA 369 30 1 Y 1 A LEU 370 ? A LEU 370 31 1 Y 1 A PRO 371 ? A PRO 371 32 1 Y 1 A ALA 372 ? A ALA 372 33 1 Y 1 A GLN 373 ? A GLN 373 34 1 Y 1 A GLU 374 ? A GLU 374 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 SINEFUNGIN SFG 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 421 421 ACT ACT A . C 3 SFG 1 5635 5635 SFG SFG A . D 4 HOH 1 5636 2 HOH HOH A . D 4 HOH 2 5637 3 HOH HOH A . D 4 HOH 3 5638 4 HOH HOH A . D 4 HOH 4 5639 6 HOH HOH A . D 4 HOH 5 5640 7 HOH HOH A . D 4 HOH 6 5641 9 HOH HOH A . D 4 HOH 7 5642 10 HOH HOH A . D 4 HOH 8 5643 14 HOH HOH A . D 4 HOH 9 5644 15 HOH HOH A . D 4 HOH 10 5645 25 HOH HOH A . D 4 HOH 11 5646 29 HOH HOH A . D 4 HOH 12 5647 30 HOH HOH A . D 4 HOH 13 5648 36 HOH HOH A . D 4 HOH 14 5649 38 HOH HOH A . D 4 HOH 15 5650 46 HOH HOH A . D 4 HOH 16 5651 47 HOH HOH A . D 4 HOH 17 5652 48 HOH HOH A . D 4 HOH 18 5653 56 HOH HOH A . D 4 HOH 19 5654 58 HOH HOH A . D 4 HOH 20 5655 59 HOH HOH A . D 4 HOH 21 5656 61 HOH HOH A . D 4 HOH 22 5657 63 HOH HOH A . D 4 HOH 23 5658 64 HOH HOH A . D 4 HOH 24 5659 67 HOH HOH A . D 4 HOH 25 5660 69 HOH HOH A . D 4 HOH 26 5661 77 HOH HOH A . #