data_1XFN # _entry.id 1XFN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XFN pdb_00001xfn 10.2210/pdb1xfn/pdb RCSB RCSB030308 ? ? WWPDB D_1000030308 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1ODV . unspecified PDB 2phy . unspecified PDB 1XFQ 'NMR structure of the blue shifted intermediate state' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XFN _pdbx_database_status.recvd_initial_deposition_date 2004-09-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bernard, C.' 1 'Houben, K.' 2 'Derix, N.M.' 3 'Marks, D.' 4 'van der Horst, M.A.' 5 'Hellingwerf, K.J.' 6 'Boelens, R.' 7 'Kaptein, R.' 8 'van Nuland, N.A.' 9 # _citation.id primary _citation.title 'The solution structure of a transient photoreceptor intermediate: delta25 photoactive yellow protein' _citation.journal_abbrev STRUCTURE _citation.journal_volume 13 _citation.page_first 953 _citation.page_last 962 _citation.year 2005 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16004868 _citation.pdbx_database_id_DOI 10.1016/j.str.2005.04.017 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bernard, C.' 1 ? primary 'Houben, K.' 2 ? primary 'Derix, N.M.' 3 ? primary 'Marks, D.' 4 ? primary 'van der Horst, M.A.' 5 ? primary 'Hellingwerf, K.J.' 6 ? primary 'Boelens, R.' 7 ? primary 'Kaptein, R.' 8 ? primary 'van Nuland, N.A.' 9 ? # _cell.entry_id 1XFN _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XFN _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Photoactive yellow protein' 12816.266 1 ? ? 'residues 26-125' ? 2 non-polymer syn ;4'-HYDROXYCINNAMIC ACID ; 164.158 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PYP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHESDDDDKLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMF EYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHESDDDDKLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMF EYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 GLU n 1 8 SER n 1 9 ASP n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 LYS n 1 14 LEU n 1 15 ALA n 1 16 PHE n 1 17 GLY n 1 18 ALA n 1 19 ILE n 1 20 GLN n 1 21 LEU n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLY n 1 26 ASN n 1 27 ILE n 1 28 LEU n 1 29 GLN n 1 30 TYR n 1 31 ASN n 1 32 ALA n 1 33 ALA n 1 34 GLU n 1 35 GLY n 1 36 ASP n 1 37 ILE n 1 38 THR n 1 39 GLY n 1 40 ARG n 1 41 ASP n 1 42 PRO n 1 43 LYS n 1 44 GLN n 1 45 VAL n 1 46 ILE n 1 47 GLY n 1 48 LYS n 1 49 ASN n 1 50 PHE n 1 51 PHE n 1 52 LYS n 1 53 ASP n 1 54 VAL n 1 55 ALA n 1 56 PRO n 1 57 CYS n 1 58 THR n 1 59 ASP n 1 60 SER n 1 61 PRO n 1 62 GLU n 1 63 PHE n 1 64 TYR n 1 65 GLY n 1 66 LYS n 1 67 PHE n 1 68 LYS n 1 69 GLU n 1 70 GLY n 1 71 VAL n 1 72 ALA n 1 73 SER n 1 74 GLY n 1 75 ASN n 1 76 LEU n 1 77 ASN n 1 78 THR n 1 79 MET n 1 80 PHE n 1 81 GLU n 1 82 TYR n 1 83 THR n 1 84 PHE n 1 85 ASP n 1 86 TYR n 1 87 GLN n 1 88 MET n 1 89 THR n 1 90 PRO n 1 91 THR n 1 92 LYS n 1 93 VAL n 1 94 LYS n 1 95 VAL n 1 96 HIS n 1 97 MET n 1 98 LYS n 1 99 LYS n 1 100 ALA n 1 101 LEU n 1 102 SER n 1 103 GLY n 1 104 ASP n 1 105 SER n 1 106 TYR n 1 107 TRP n 1 108 VAL n 1 109 PHE n 1 110 VAL n 1 111 LYS n 1 112 ARG n 1 113 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Halorhodospira _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halorhodospira halophila' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1053 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYP_ECTHA _struct_ref.pdbx_db_accession P16113 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKV KVHMKKALSGDSYWVFVKRV ; _struct_ref.pdbx_align_begin 26 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XFN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16113 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 26 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1XFN HIS A 1 ? UNP P16113 ? ? 'expression tag' 13 1 1 1XFN HIS A 2 ? UNP P16113 ? ? 'expression tag' 14 2 1 1XFN HIS A 3 ? UNP P16113 ? ? 'expression tag' 15 3 1 1XFN HIS A 4 ? UNP P16113 ? ? 'expression tag' 16 4 1 1XFN HIS A 5 ? UNP P16113 ? ? 'expression tag' 17 5 1 1XFN HIS A 6 ? UNP P16113 ? ? 'expression tag' 18 6 1 1XFN GLU A 7 ? UNP P16113 ? ? 'expression tag' 19 7 1 1XFN SER A 8 ? UNP P16113 ? ? 'expression tag' 20 8 1 1XFN ASP A 9 ? UNP P16113 ? ? 'expression tag' 21 9 1 1XFN ASP A 10 ? UNP P16113 ? ? 'expression tag' 22 10 1 1XFN ASP A 11 ? UNP P16113 ? ? 'expression tag' 23 11 1 1XFN ASP A 12 ? UNP P16113 ? ? 'expression tag' 24 12 1 1XFN LYS A 13 ? UNP P16113 ? ? 'expression tag' 25 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HC4 non-polymer . ;4'-HYDROXYCINNAMIC ACID ; 'PARA-COUMARIC ACID' 'C9 H8 O3' 164.158 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 HNCA 2 1 1 'CBCA(CO)NH' 3 2 1 '3D 15N TOCSY-HSQC' 4 2 1 3D_15N-separated_NOESY 5 2 1 '2D NOESY' 6 2 1 '2D TOCSY' 7 1 1 HNCO 8 1 1 HNACB 9 1 1 '13C filtered 2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM Delta25-PYP, 15N-13C, 50mM phosphate buffer' '90% H2O/10% D2O' 2 '1mM Delta25-PYP 15N, 50mM phosphate buffer' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 900 2 ? Bruker AVANCE 500 3 ? Bruker AVANCE 750 # _pdbx_nmr_refine.entry_id 1XFN _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1XFN _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1XFN _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.1 collection bruker 1 NMRPipe ? processing johnsin 2 CNS 1.2 'structure solution' Brunger 3 CNS 1.2 refinement Brunger 4 NMRView 5.0.4 'data analysis' Delaglio 5 # _exptl.entry_id 1XFN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1XFN _struct.title 'NMR structure of the ground state of the photoactive yellow protein lacking the N-terminal part' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XFN _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'PAS DOMAIN, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PHE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 63 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 74 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PHE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 75 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 86 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 57 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id HC4 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 69 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id HC4 _struct_conn.ptnr2_auth_seq_id 169 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.820 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 17 ? LEU A 21 ? GLY A 29 LEU A 33 A 2 TYR A 106 ? ARG A 112 ? TYR A 118 ARG A 124 A 3 THR A 91 ? LYS A 99 ? THR A 103 LYS A 111 A 4 ASN A 77 ? PHE A 84 ? ASN A 89 PHE A 96 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 21 ? N LEU A 33 O TYR A 106 ? O TYR A 118 A 2 3 O TRP A 107 ? O TRP A 119 N LYS A 98 ? N LYS A 110 A 3 4 O VAL A 95 ? O VAL A 107 N PHE A 80 ? N PHE A 92 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HC4 _struct_site.pdbx_auth_seq_id 169 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'BINDING SITE FOR RESIDUE HC4 A 169' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 GLU A 34 ? GLU A 46 . ? 1_555 ? 2 AC1 10 THR A 38 ? THR A 50 . ? 1_555 ? 3 AC1 10 ALA A 55 ? ALA A 67 . ? 1_555 ? 4 AC1 10 PRO A 56 ? PRO A 68 . ? 1_555 ? 5 AC1 10 CYS A 57 ? CYS A 69 . ? 1_555 ? 6 AC1 10 PHE A 84 ? PHE A 96 . ? 1_555 ? 7 AC1 10 ASP A 85 ? ASP A 97 . ? 1_555 ? 8 AC1 10 TYR A 86 ? TYR A 98 . ? 1_555 ? 9 AC1 10 GLN A 87 ? GLN A 99 . ? 1_555 ? 10 AC1 10 MET A 88 ? MET A 100 . ? 1_555 ? # _database_PDB_matrix.entry_id 1XFN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XFN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 13 ? ? ? A . n A 1 2 HIS 2 14 ? ? ? A . n A 1 3 HIS 3 15 ? ? ? A . n A 1 4 HIS 4 16 ? ? ? A . n A 1 5 HIS 5 17 ? ? ? A . n A 1 6 HIS 6 18 ? ? ? A . n A 1 7 GLU 7 19 ? ? ? A . n A 1 8 SER 8 20 ? ? ? A . n A 1 9 ASP 9 21 ? ? ? A . n A 1 10 ASP 10 22 ? ? ? A . n A 1 11 ASP 11 23 ? ? ? A . n A 1 12 ASP 12 24 ? ? ? A . n A 1 13 LYS 13 25 ? ? ? A . n A 1 14 LEU 14 26 26 LEU LEU A . n A 1 15 ALA 15 27 27 ALA ALA A . n A 1 16 PHE 16 28 28 PHE PHE A . n A 1 17 GLY 17 29 29 GLY GLY A . n A 1 18 ALA 18 30 30 ALA ALA A . n A 1 19 ILE 19 31 31 ILE ILE A . n A 1 20 GLN 20 32 32 GLN GLN A . n A 1 21 LEU 21 33 33 LEU LEU A . n A 1 22 ASP 22 34 34 ASP ASP A . n A 1 23 GLY 23 35 35 GLY GLY A . n A 1 24 ASP 24 36 36 ASP ASP A . n A 1 25 GLY 25 37 37 GLY GLY A . n A 1 26 ASN 26 38 38 ASN ASN A . n A 1 27 ILE 27 39 39 ILE ILE A . n A 1 28 LEU 28 40 40 LEU LEU A . n A 1 29 GLN 29 41 41 GLN GLN A . n A 1 30 TYR 30 42 42 TYR TYR A . n A 1 31 ASN 31 43 43 ASN ASN A . n A 1 32 ALA 32 44 44 ALA ALA A . n A 1 33 ALA 33 45 45 ALA ALA A . n A 1 34 GLU 34 46 46 GLU GLU A . n A 1 35 GLY 35 47 47 GLY GLY A . n A 1 36 ASP 36 48 48 ASP ASP A . n A 1 37 ILE 37 49 49 ILE ILE A . n A 1 38 THR 38 50 50 THR THR A . n A 1 39 GLY 39 51 51 GLY GLY A . n A 1 40 ARG 40 52 52 ARG ARG A . n A 1 41 ASP 41 53 53 ASP ASP A . n A 1 42 PRO 42 54 54 PRO PRO A . n A 1 43 LYS 43 55 55 LYS LYS A . n A 1 44 GLN 44 56 56 GLN GLN A . n A 1 45 VAL 45 57 57 VAL VAL A . n A 1 46 ILE 46 58 58 ILE ILE A . n A 1 47 GLY 47 59 59 GLY GLY A . n A 1 48 LYS 48 60 60 LYS LYS A . n A 1 49 ASN 49 61 61 ASN ASN A . n A 1 50 PHE 50 62 62 PHE PHE A . n A 1 51 PHE 51 63 63 PHE PHE A . n A 1 52 LYS 52 64 64 LYS LYS A . n A 1 53 ASP 53 65 65 ASP ASP A . n A 1 54 VAL 54 66 66 VAL VAL A . n A 1 55 ALA 55 67 67 ALA ALA A . n A 1 56 PRO 56 68 68 PRO PRO A . n A 1 57 CYS 57 69 69 CYS CYS A . n A 1 58 THR 58 70 70 THR THR A . n A 1 59 ASP 59 71 71 ASP ASP A . n A 1 60 SER 60 72 72 SER SER A . n A 1 61 PRO 61 73 73 PRO PRO A . n A 1 62 GLU 62 74 74 GLU GLU A . n A 1 63 PHE 63 75 75 PHE PHE A . n A 1 64 TYR 64 76 76 TYR TYR A . n A 1 65 GLY 65 77 77 GLY GLY A . n A 1 66 LYS 66 78 78 LYS LYS A . n A 1 67 PHE 67 79 79 PHE PHE A . n A 1 68 LYS 68 80 80 LYS LYS A . n A 1 69 GLU 69 81 81 GLU GLU A . n A 1 70 GLY 70 82 82 GLY GLY A . n A 1 71 VAL 71 83 83 VAL VAL A . n A 1 72 ALA 72 84 84 ALA ALA A . n A 1 73 SER 73 85 85 SER SER A . n A 1 74 GLY 74 86 86 GLY GLY A . n A 1 75 ASN 75 87 87 ASN ASN A . n A 1 76 LEU 76 88 88 LEU LEU A . n A 1 77 ASN 77 89 89 ASN ASN A . n A 1 78 THR 78 90 90 THR THR A . n A 1 79 MET 79 91 91 MET MET A . n A 1 80 PHE 80 92 92 PHE PHE A . n A 1 81 GLU 81 93 93 GLU GLU A . n A 1 82 TYR 82 94 94 TYR TYR A . n A 1 83 THR 83 95 95 THR THR A . n A 1 84 PHE 84 96 96 PHE PHE A . n A 1 85 ASP 85 97 97 ASP ASP A . n A 1 86 TYR 86 98 98 TYR TYR A . n A 1 87 GLN 87 99 99 GLN GLN A . n A 1 88 MET 88 100 100 MET MET A . n A 1 89 THR 89 101 101 THR THR A . n A 1 90 PRO 90 102 102 PRO PRO A . n A 1 91 THR 91 103 103 THR THR A . n A 1 92 LYS 92 104 104 LYS LYS A . n A 1 93 VAL 93 105 105 VAL VAL A . n A 1 94 LYS 94 106 106 LYS LYS A . n A 1 95 VAL 95 107 107 VAL VAL A . n A 1 96 HIS 96 108 108 HIS HIS A . n A 1 97 MET 97 109 109 MET MET A . n A 1 98 LYS 98 110 110 LYS LYS A . n A 1 99 LYS 99 111 111 LYS LYS A . n A 1 100 ALA 100 112 112 ALA ALA A . n A 1 101 LEU 101 113 113 LEU LEU A . n A 1 102 SER 102 114 114 SER SER A . n A 1 103 GLY 103 115 115 GLY GLY A . n A 1 104 ASP 104 116 116 ASP ASP A . n A 1 105 SER 105 117 117 SER SER A . n A 1 106 TYR 106 118 118 TYR TYR A . n A 1 107 TRP 107 119 119 TRP TRP A . n A 1 108 VAL 108 120 120 VAL VAL A . n A 1 109 PHE 109 121 121 PHE PHE A . n A 1 110 VAL 110 122 122 VAL VAL A . n A 1 111 LYS 111 123 123 LYS LYS A . n A 1 112 ARG 112 124 124 ARG ARG A . n A 1 113 VAL 113 125 125 VAL VAL A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HC4 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 169 _pdbx_nonpoly_scheme.auth_seq_num 169 _pdbx_nonpoly_scheme.pdb_mon_id HC4 _pdbx_nonpoly_scheme.auth_mon_id HC4 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-08-16 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HG21 A VAL 83 ? ? HH A TYR 118 ? ? 1.34 2 2 H A LEU 26 ? ? OD1 A ASP 48 ? ? 1.54 3 2 HZ3 A LYS 60 ? ? OD2 A ASP 65 ? ? 1.59 4 3 HD1 A TYR 94 ? ? H A THR 95 ? ? 1.13 5 3 HZ3 A LYS 123 ? ? O A VAL 125 ? ? 1.60 6 5 HB2 A TYR 42 ? ? HA A PRO 54 ? ? 1.24 7 6 H A TYR 42 ? ? HB3 A PRO 54 ? ? 1.33 8 7 HE2 A PHE 75 ? ? HG11 A VAL 107 ? ? 1.29 9 7 HB2 A TYR 42 ? ? HA A PRO 54 ? ? 1.33 10 8 OE1 A GLU 46 ? ? HH12 A ARG 124 ? ? 1.58 11 9 HG A SER 72 ? ? HH A TYR 94 ? ? 1.12 12 10 HG3 A GLU 46 ? ? HA3 A GLY 51 ? ? 1.24 13 11 HB3 A LEU 88 ? ? HB2 A LYS 111 ? ? 1.34 14 12 HB2 A TYR 42 ? ? HA A PRO 54 ? ? 1.29 15 13 HD1 A PHE 92 ? ? HD1 A TYR 94 ? ? 1.28 16 13 HE1 A TYR 42 ? ? HB2 A ARG 52 ? ? 1.35 17 13 HG A SER 72 ? ? OE1 A GLU 74 ? ? 1.55 18 15 HB2 A TYR 42 ? ? HA A PRO 54 ? ? 1.21 19 16 HH A TYR 76 ? ? HZ3 A LYS 80 ? ? 1.18 20 17 HD13 A ILE 39 ? ? HB2 A PHE 62 ? ? 1.22 21 17 HA3 A GLY 82 ? ? HB2 A LEU 88 ? ? 1.24 22 18 HH A TYR 76 ? ? HZ2 A LYS 80 ? ? 1.12 23 18 HD11 A ILE 39 ? ? HB2 A PHE 62 ? ? 1.14 24 18 OE1 A GLU 93 ? ? HZ3 A LYS 104 ? ? 1.60 25 19 HD11 A LEU 113 ? ? H A SER 117 ? ? 1.13 26 19 HB2 A TYR 42 ? ? HA A PRO 54 ? ? 1.25 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.337 1.544 -0.207 0.023 N 2 1 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.322 1.544 -0.222 0.023 N 3 1 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.455 1.252 0.203 0.011 N 4 1 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.326 1.544 -0.218 0.023 N 5 1 CA A THR 50 ? ? CB A THR 50 ? ? 1.316 1.529 -0.213 0.026 N 6 1 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.320 1.543 -0.223 0.021 N 7 1 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.328 1.544 -0.216 0.023 N 8 1 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.338 1.543 -0.205 0.021 N 9 1 CA A THR 70 ? ? CB A THR 70 ? ? 1.318 1.529 -0.211 0.026 N 10 1 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.328 1.543 -0.215 0.021 N 11 1 CA A THR 90 ? ? CB A THR 90 ? ? 1.331 1.529 -0.198 0.026 N 12 1 CA A THR 95 ? ? CB A THR 95 ? ? 1.322 1.529 -0.207 0.026 N 13 1 CA A THR 101 ? ? CB A THR 101 ? ? 1.319 1.529 -0.210 0.026 N 14 1 CA A THR 103 ? ? CB A THR 103 ? ? 1.323 1.529 -0.206 0.026 N 15 1 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.327 1.543 -0.216 0.021 N 16 1 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 17 1 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.334 1.543 -0.209 0.021 N 18 1 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.327 1.543 -0.216 0.021 N 19 1 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.329 1.543 -0.214 0.021 N 20 2 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.331 1.544 -0.213 0.023 N 21 2 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.328 1.544 -0.216 0.023 N 22 2 CE1 A TYR 42 ? ? CZ A TYR 42 ? ? 1.299 1.381 -0.082 0.013 N 23 2 CZ A TYR 42 ? ? CE2 A TYR 42 ? ? 1.459 1.381 0.078 0.013 N 24 2 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.452 1.252 0.200 0.011 N 25 2 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.327 1.544 -0.217 0.023 N 26 2 CA A THR 50 ? ? CB A THR 50 ? ? 1.319 1.529 -0.210 0.026 N 27 2 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.323 1.543 -0.220 0.021 N 28 2 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.326 1.544 -0.218 0.023 N 29 2 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.318 1.543 -0.225 0.021 N 30 2 CA A THR 70 ? ? CB A THR 70 ? ? 1.315 1.529 -0.214 0.026 N 31 2 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.325 1.543 -0.218 0.021 N 32 2 CA A THR 90 ? ? CB A THR 90 ? ? 1.333 1.529 -0.196 0.026 N 33 2 CA A THR 95 ? ? CB A THR 95 ? ? 1.323 1.529 -0.206 0.026 N 34 2 CA A THR 101 ? ? CB A THR 101 ? ? 1.320 1.529 -0.209 0.026 N 35 2 CA A THR 103 ? ? CB A THR 103 ? ? 1.326 1.529 -0.203 0.026 N 36 2 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.331 1.543 -0.212 0.021 N 37 2 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.335 1.543 -0.208 0.021 N 38 2 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.338 1.543 -0.205 0.021 N 39 2 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.330 1.543 -0.213 0.021 N 40 2 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.328 1.543 -0.215 0.021 N 41 3 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.334 1.544 -0.210 0.023 N 42 3 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.324 1.544 -0.220 0.023 N 43 3 CE1 A TYR 42 ? ? CZ A TYR 42 ? ? 1.275 1.381 -0.106 0.013 N 44 3 CZ A TYR 42 ? ? CE2 A TYR 42 ? ? 1.480 1.381 0.099 0.013 N 45 3 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.458 1.252 0.206 0.011 N 46 3 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.316 1.544 -0.228 0.023 N 47 3 CA A THR 50 ? ? CB A THR 50 ? ? 1.333 1.529 -0.196 0.026 N 48 3 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.324 1.543 -0.219 0.021 N 49 3 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.330 1.544 -0.214 0.023 N 50 3 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.338 1.543 -0.205 0.021 N 51 3 CA A THR 70 ? ? CB A THR 70 ? ? 1.318 1.529 -0.211 0.026 N 52 3 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.327 1.543 -0.216 0.021 N 53 3 CA A THR 90 ? ? CB A THR 90 ? ? 1.333 1.529 -0.196 0.026 N 54 3 CA A THR 95 ? ? CB A THR 95 ? ? 1.326 1.529 -0.203 0.026 N 55 3 CA A THR 101 ? ? CB A THR 101 ? ? 1.337 1.529 -0.192 0.026 N 56 3 CA A THR 103 ? ? CB A THR 103 ? ? 1.330 1.529 -0.199 0.026 N 57 3 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.326 1.543 -0.217 0.021 N 58 3 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.328 1.543 -0.215 0.021 N 59 3 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.335 1.543 -0.208 0.021 N 60 3 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.328 1.543 -0.215 0.021 N 61 3 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.331 1.543 -0.212 0.021 N 62 4 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.337 1.544 -0.207 0.023 N 63 4 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.326 1.544 -0.218 0.023 N 64 4 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.453 1.252 0.201 0.011 N 65 4 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.332 1.544 -0.212 0.023 N 66 4 CA A THR 50 ? ? CB A THR 50 ? ? 1.332 1.529 -0.197 0.026 N 67 4 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.327 1.543 -0.216 0.021 N 68 4 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.325 1.544 -0.219 0.023 N 69 4 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.327 1.543 -0.216 0.021 N 70 4 CA A THR 70 ? ? CB A THR 70 ? ? 1.310 1.529 -0.219 0.026 N 71 4 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.327 1.543 -0.216 0.021 N 72 4 CA A THR 90 ? ? CB A THR 90 ? ? 1.331 1.529 -0.198 0.026 N 73 4 CA A THR 95 ? ? CB A THR 95 ? ? 1.317 1.529 -0.212 0.026 N 74 4 CA A THR 101 ? ? CB A THR 101 ? ? 1.322 1.529 -0.207 0.026 N 75 4 CA A THR 103 ? ? CB A THR 103 ? ? 1.317 1.529 -0.212 0.026 N 76 4 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.334 1.543 -0.209 0.021 N 77 4 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.332 1.543 -0.211 0.021 N 78 4 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.339 1.543 -0.204 0.021 N 79 4 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 80 4 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.327 1.543 -0.216 0.021 N 81 5 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.346 1.544 -0.198 0.023 N 82 5 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.326 1.544 -0.218 0.023 N 83 5 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.454 1.252 0.202 0.011 N 84 5 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.329 1.544 -0.215 0.023 N 85 5 CA A THR 50 ? ? CB A THR 50 ? ? 1.319 1.529 -0.210 0.026 N 86 5 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.322 1.543 -0.221 0.021 N 87 5 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.329 1.544 -0.215 0.023 N 88 5 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.336 1.543 -0.207 0.021 N 89 5 CA A THR 70 ? ? CB A THR 70 ? ? 1.318 1.529 -0.211 0.026 N 90 5 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.328 1.543 -0.215 0.021 N 91 5 CA A THR 90 ? ? CB A THR 90 ? ? 1.331 1.529 -0.198 0.026 N 92 5 CA A THR 95 ? ? CB A THR 95 ? ? 1.321 1.529 -0.208 0.026 N 93 5 CA A THR 101 ? ? CB A THR 101 ? ? 1.316 1.529 -0.213 0.026 N 94 5 CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 95 5 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.329 1.543 -0.214 0.021 N 96 5 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.335 1.543 -0.208 0.021 N 97 5 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.334 1.543 -0.209 0.021 N 98 5 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.331 1.543 -0.212 0.021 N 99 5 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.337 1.543 -0.206 0.021 N 100 6 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.326 1.544 -0.218 0.023 N 101 6 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.323 1.544 -0.221 0.023 N 102 6 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.457 1.252 0.205 0.011 N 103 6 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.327 1.544 -0.217 0.023 N 104 6 CA A THR 50 ? ? CB A THR 50 ? ? 1.324 1.529 -0.205 0.026 N 105 6 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.325 1.543 -0.218 0.021 N 106 6 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.323 1.544 -0.221 0.023 N 107 6 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.324 1.543 -0.219 0.021 N 108 6 CA A THR 70 ? ? CB A THR 70 ? ? 1.327 1.529 -0.202 0.026 N 109 6 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.331 1.543 -0.212 0.021 N 110 6 CA A THR 90 ? ? CB A THR 90 ? ? 1.334 1.529 -0.195 0.026 N 111 6 CA A THR 95 ? ? CB A THR 95 ? ? 1.317 1.529 -0.212 0.026 N 112 6 CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 113 6 CA A THR 103 ? ? CB A THR 103 ? ? 1.325 1.529 -0.204 0.026 N 114 6 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.330 1.543 -0.213 0.021 N 115 6 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.327 1.543 -0.216 0.021 N 116 6 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 117 6 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.326 1.543 -0.217 0.021 N 118 6 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.331 1.543 -0.212 0.021 N 119 7 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.333 1.544 -0.211 0.023 N 120 7 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.323 1.544 -0.221 0.023 N 121 7 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.458 1.252 0.206 0.011 N 122 7 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.326 1.544 -0.218 0.023 N 123 7 CA A THR 50 ? ? CB A THR 50 ? ? 1.312 1.529 -0.217 0.026 N 124 7 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.322 1.543 -0.221 0.021 N 125 7 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.332 1.544 -0.212 0.023 N 126 7 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.340 1.543 -0.203 0.021 N 127 7 CA A THR 70 ? ? CB A THR 70 ? ? 1.319 1.529 -0.210 0.026 N 128 7 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 129 7 CA A THR 90 ? ? CB A THR 90 ? ? 1.317 1.529 -0.212 0.026 N 130 7 CA A THR 95 ? ? CB A THR 95 ? ? 1.319 1.529 -0.210 0.026 N 131 7 CA A THR 101 ? ? CB A THR 101 ? ? 1.322 1.529 -0.207 0.026 N 132 7 CA A THR 103 ? ? CB A THR 103 ? ? 1.316 1.529 -0.213 0.026 N 133 7 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.329 1.543 -0.214 0.021 N 134 7 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.335 1.543 -0.208 0.021 N 135 7 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 136 7 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.327 1.543 -0.216 0.021 N 137 7 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.339 1.543 -0.204 0.021 N 138 8 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.334 1.544 -0.210 0.023 N 139 8 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.323 1.544 -0.221 0.023 N 140 8 CE1 A TYR 42 ? ? CZ A TYR 42 ? ? 1.295 1.381 -0.086 0.013 N 141 8 CZ A TYR 42 ? ? CE2 A TYR 42 ? ? 1.463 1.381 0.082 0.013 N 142 8 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.455 1.252 0.203 0.011 N 143 8 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.326 1.544 -0.218 0.023 N 144 8 CA A THR 50 ? ? CB A THR 50 ? ? 1.315 1.529 -0.214 0.026 N 145 8 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.324 1.543 -0.219 0.021 N 146 8 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.327 1.544 -0.217 0.023 N 147 8 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.314 1.543 -0.229 0.021 N 148 8 CA A THR 70 ? ? CB A THR 70 ? ? 1.314 1.529 -0.215 0.026 N 149 8 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 150 8 CA A THR 90 ? ? CB A THR 90 ? ? 1.333 1.529 -0.196 0.026 N 151 8 CA A THR 95 ? ? CB A THR 95 ? ? 1.317 1.529 -0.212 0.026 N 152 8 CA A THR 101 ? ? CB A THR 101 ? ? 1.319 1.529 -0.210 0.026 N 153 8 CA A THR 103 ? ? CB A THR 103 ? ? 1.323 1.529 -0.206 0.026 N 154 8 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.335 1.543 -0.208 0.021 N 155 8 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.324 1.543 -0.219 0.021 N 156 8 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.336 1.543 -0.207 0.021 N 157 8 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.327 1.543 -0.216 0.021 N 158 8 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.331 1.543 -0.212 0.021 N 159 9 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.340 1.544 -0.204 0.023 N 160 9 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.327 1.544 -0.217 0.023 N 161 9 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.457 1.252 0.205 0.011 N 162 9 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.326 1.544 -0.218 0.023 N 163 9 CA A THR 50 ? ? CB A THR 50 ? ? 1.319 1.529 -0.210 0.026 N 164 9 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.323 1.543 -0.220 0.021 N 165 9 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.326 1.544 -0.218 0.023 N 166 9 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.321 1.543 -0.222 0.021 N 167 9 CA A THR 70 ? ? CB A THR 70 ? ? 1.328 1.529 -0.201 0.026 N 168 9 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.330 1.543 -0.213 0.021 N 169 9 CA A THR 90 ? ? CB A THR 90 ? ? 1.332 1.529 -0.197 0.026 N 170 9 CA A THR 95 ? ? CB A THR 95 ? ? 1.325 1.529 -0.204 0.026 N 171 9 CA A THR 101 ? ? CB A THR 101 ? ? 1.340 1.529 -0.189 0.026 N 172 9 CA A THR 103 ? ? CB A THR 103 ? ? 1.314 1.529 -0.215 0.026 N 173 9 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.336 1.543 -0.207 0.021 N 174 9 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.333 1.543 -0.210 0.021 N 175 9 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.340 1.543 -0.203 0.021 N 176 9 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.328 1.543 -0.215 0.021 N 177 9 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.327 1.543 -0.216 0.021 N 178 10 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.340 1.544 -0.204 0.023 N 179 10 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.327 1.544 -0.217 0.023 N 180 10 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.454 1.252 0.202 0.011 N 181 10 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.324 1.544 -0.220 0.023 N 182 10 CA A THR 50 ? ? CB A THR 50 ? ? 1.339 1.529 -0.190 0.026 N 183 10 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.329 1.543 -0.214 0.021 N 184 10 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.325 1.544 -0.219 0.023 N 185 10 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.325 1.543 -0.218 0.021 N 186 10 CA A THR 70 ? ? CB A THR 70 ? ? 1.315 1.529 -0.214 0.026 N 187 10 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.328 1.543 -0.215 0.021 N 188 10 CA A THR 90 ? ? CB A THR 90 ? ? 1.322 1.529 -0.207 0.026 N 189 10 CA A THR 95 ? ? CB A THR 95 ? ? 1.320 1.529 -0.209 0.026 N 190 10 CA A THR 101 ? ? CB A THR 101 ? ? 1.335 1.529 -0.194 0.026 N 191 10 CA A THR 103 ? ? CB A THR 103 ? ? 1.328 1.529 -0.201 0.026 N 192 10 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.327 1.543 -0.216 0.021 N 193 10 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 194 10 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 195 10 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.327 1.543 -0.216 0.021 N 196 10 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.326 1.543 -0.217 0.021 N 197 11 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.320 1.544 -0.224 0.023 N 198 11 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.319 1.544 -0.225 0.023 N 199 11 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.456 1.252 0.204 0.011 N 200 11 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.327 1.544 -0.217 0.023 N 201 11 CA A THR 50 ? ? CB A THR 50 ? ? 1.330 1.529 -0.199 0.026 N 202 11 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.324 1.543 -0.219 0.021 N 203 11 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.332 1.544 -0.212 0.023 N 204 11 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.339 1.543 -0.204 0.021 N 205 11 CA A THR 70 ? ? CB A THR 70 ? ? 1.315 1.529 -0.214 0.026 N 206 11 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 207 11 CA A THR 90 ? ? CB A THR 90 ? ? 1.332 1.529 -0.197 0.026 N 208 11 CA A THR 95 ? ? CB A THR 95 ? ? 1.318 1.529 -0.211 0.026 N 209 11 CA A THR 101 ? ? CB A THR 101 ? ? 1.317 1.529 -0.212 0.026 N 210 11 CA A THR 103 ? ? CB A THR 103 ? ? 1.317 1.529 -0.212 0.026 N 211 11 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.329 1.543 -0.214 0.021 N 212 11 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.337 1.543 -0.206 0.021 N 213 11 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 214 11 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.328 1.543 -0.215 0.021 N 215 11 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.329 1.543 -0.214 0.021 N 216 12 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.335 1.544 -0.209 0.023 N 217 12 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.326 1.544 -0.218 0.023 N 218 12 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.456 1.252 0.204 0.011 N 219 12 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.327 1.544 -0.217 0.023 N 220 12 CA A THR 50 ? ? CB A THR 50 ? ? 1.319 1.529 -0.210 0.026 N 221 12 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.334 1.543 -0.209 0.021 N 222 12 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.332 1.544 -0.212 0.023 N 223 12 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.335 1.543 -0.208 0.021 N 224 12 CA A THR 70 ? ? CB A THR 70 ? ? 1.313 1.529 -0.216 0.026 N 225 12 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 226 12 CA A THR 90 ? ? CB A THR 90 ? ? 1.331 1.529 -0.198 0.026 N 227 12 CA A THR 95 ? ? CB A THR 95 ? ? 1.323 1.529 -0.206 0.026 N 228 12 CA A THR 101 ? ? CB A THR 101 ? ? 1.316 1.529 -0.213 0.026 N 229 12 CA A THR 103 ? ? CB A THR 103 ? ? 1.320 1.529 -0.209 0.026 N 230 12 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.326 1.543 -0.217 0.021 N 231 12 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.325 1.543 -0.218 0.021 N 232 12 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.328 1.543 -0.215 0.021 N 233 12 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.333 1.543 -0.210 0.021 N 234 12 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.327 1.543 -0.216 0.021 N 235 13 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.336 1.544 -0.208 0.023 N 236 13 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.327 1.544 -0.217 0.023 N 237 13 CE1 A TYR 42 ? ? CZ A TYR 42 ? ? 1.289 1.381 -0.092 0.013 N 238 13 CZ A TYR 42 ? ? CE2 A TYR 42 ? ? 1.470 1.381 0.089 0.013 N 239 13 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.457 1.252 0.205 0.011 N 240 13 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.319 1.544 -0.225 0.023 N 241 13 CA A THR 50 ? ? CB A THR 50 ? ? 1.312 1.529 -0.217 0.026 N 242 13 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.327 1.543 -0.216 0.021 N 243 13 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.329 1.544 -0.215 0.023 N 244 13 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.330 1.543 -0.213 0.021 N 245 13 CA A THR 70 ? ? CB A THR 70 ? ? 1.312 1.529 -0.217 0.026 N 246 13 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.327 1.543 -0.216 0.021 N 247 13 CA A THR 90 ? ? CB A THR 90 ? ? 1.321 1.529 -0.208 0.026 N 248 13 CA A THR 95 ? ? CB A THR 95 ? ? 1.335 1.529 -0.194 0.026 N 249 13 CA A THR 101 ? ? CB A THR 101 ? ? 1.337 1.529 -0.192 0.026 N 250 13 CA A THR 103 ? ? CB A THR 103 ? ? 1.319 1.529 -0.210 0.026 N 251 13 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.330 1.543 -0.213 0.021 N 252 13 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.333 1.543 -0.210 0.021 N 253 13 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.339 1.543 -0.204 0.021 N 254 13 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 255 13 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.329 1.543 -0.214 0.021 N 256 14 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.341 1.544 -0.203 0.023 N 257 14 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.323 1.544 -0.221 0.023 N 258 14 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.455 1.252 0.203 0.011 N 259 14 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.331 1.544 -0.213 0.023 N 260 14 CA A THR 50 ? ? CB A THR 50 ? ? 1.333 1.529 -0.196 0.026 N 261 14 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.323 1.543 -0.220 0.021 N 262 14 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.332 1.544 -0.212 0.023 N 263 14 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.337 1.543 -0.206 0.021 N 264 14 CA A THR 70 ? ? CB A THR 70 ? ? 1.311 1.529 -0.218 0.026 N 265 14 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.328 1.543 -0.215 0.021 N 266 14 CA A THR 90 ? ? CB A THR 90 ? ? 1.332 1.529 -0.197 0.026 N 267 14 CA A THR 95 ? ? CB A THR 95 ? ? 1.321 1.529 -0.208 0.026 N 268 14 CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 269 14 CA A THR 103 ? ? CB A THR 103 ? ? 1.317 1.529 -0.212 0.026 N 270 14 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.327 1.543 -0.216 0.021 N 271 14 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.335 1.543 -0.208 0.021 N 272 14 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.337 1.543 -0.206 0.021 N 273 14 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 274 14 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.332 1.543 -0.211 0.021 N 275 15 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.321 1.544 -0.223 0.023 N 276 15 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.322 1.544 -0.222 0.023 N 277 15 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.455 1.252 0.203 0.011 N 278 15 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.328 1.544 -0.216 0.023 N 279 15 CA A THR 50 ? ? CB A THR 50 ? ? 1.333 1.529 -0.196 0.026 N 280 15 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.322 1.543 -0.221 0.021 N 281 15 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.328 1.544 -0.216 0.023 N 282 15 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.316 1.543 -0.227 0.021 N 283 15 CA A THR 70 ? ? CB A THR 70 ? ? 1.313 1.529 -0.216 0.026 N 284 15 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.328 1.543 -0.215 0.021 N 285 15 CA A THR 90 ? ? CB A THR 90 ? ? 1.323 1.529 -0.206 0.026 N 286 15 CA A THR 95 ? ? CB A THR 95 ? ? 1.322 1.529 -0.207 0.026 N 287 15 CA A THR 101 ? ? CB A THR 101 ? ? 1.316 1.529 -0.213 0.026 N 288 15 CA A THR 103 ? ? CB A THR 103 ? ? 1.324 1.529 -0.205 0.026 N 289 15 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.328 1.543 -0.215 0.021 N 290 15 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.324 1.543 -0.219 0.021 N 291 15 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 292 15 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.331 1.543 -0.212 0.021 N 293 15 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.328 1.543 -0.215 0.021 N 294 16 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.323 1.544 -0.221 0.023 N 295 16 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.324 1.544 -0.220 0.023 N 296 16 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.455 1.252 0.203 0.011 N 297 16 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.330 1.544 -0.214 0.023 N 298 16 CA A THR 50 ? ? CB A THR 50 ? ? 1.317 1.529 -0.212 0.026 N 299 16 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.324 1.543 -0.219 0.021 N 300 16 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.327 1.544 -0.217 0.023 N 301 16 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.337 1.543 -0.206 0.021 N 302 16 CA A THR 70 ? ? CB A THR 70 ? ? 1.319 1.529 -0.210 0.026 N 303 16 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 304 16 CA A THR 90 ? ? CB A THR 90 ? ? 1.324 1.529 -0.205 0.026 N 305 16 CA A THR 95 ? ? CB A THR 95 ? ? 1.323 1.529 -0.206 0.026 N 306 16 CA A THR 101 ? ? CB A THR 101 ? ? 1.334 1.529 -0.195 0.026 N 307 16 CA A THR 103 ? ? CB A THR 103 ? ? 1.321 1.529 -0.208 0.026 N 308 16 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.332 1.543 -0.211 0.021 N 309 16 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 310 16 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.331 1.543 -0.212 0.021 N 311 16 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.330 1.543 -0.213 0.021 N 312 16 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.328 1.543 -0.215 0.021 N 313 17 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.338 1.544 -0.206 0.023 N 314 17 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.330 1.544 -0.214 0.023 N 315 17 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.456 1.252 0.204 0.011 N 316 17 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.326 1.544 -0.218 0.023 N 317 17 CA A THR 50 ? ? CB A THR 50 ? ? 1.321 1.529 -0.208 0.026 N 318 17 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.321 1.543 -0.222 0.021 N 319 17 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.330 1.544 -0.214 0.023 N 320 17 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.328 1.543 -0.215 0.021 N 321 17 CA A THR 70 ? ? CB A THR 70 ? ? 1.313 1.529 -0.216 0.026 N 322 17 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 323 17 CA A THR 90 ? ? CB A THR 90 ? ? 1.320 1.529 -0.209 0.026 N 324 17 CA A THR 95 ? ? CB A THR 95 ? ? 1.324 1.529 -0.205 0.026 N 325 17 CA A THR 101 ? ? CB A THR 101 ? ? 1.314 1.529 -0.215 0.026 N 326 17 CA A THR 103 ? ? CB A THR 103 ? ? 1.326 1.529 -0.203 0.026 N 327 17 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.329 1.543 -0.214 0.021 N 328 17 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.335 1.543 -0.208 0.021 N 329 17 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.335 1.543 -0.208 0.021 N 330 17 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.327 1.543 -0.216 0.021 N 331 17 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.336 1.543 -0.207 0.021 N 332 18 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.335 1.544 -0.209 0.023 N 333 18 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.324 1.544 -0.220 0.023 N 334 18 CE1 A TYR 42 ? ? CZ A TYR 42 ? ? 1.303 1.381 -0.078 0.013 N 335 18 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.455 1.252 0.203 0.011 N 336 18 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.329 1.544 -0.215 0.023 N 337 18 CA A THR 50 ? ? CB A THR 50 ? ? 1.335 1.529 -0.194 0.026 N 338 18 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.323 1.543 -0.220 0.021 N 339 18 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.330 1.544 -0.214 0.023 N 340 18 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.315 1.543 -0.228 0.021 N 341 18 CA A THR 70 ? ? CB A THR 70 ? ? 1.313 1.529 -0.216 0.026 N 342 18 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.327 1.543 -0.216 0.021 N 343 18 CA A THR 90 ? ? CB A THR 90 ? ? 1.325 1.529 -0.204 0.026 N 344 18 CA A THR 95 ? ? CB A THR 95 ? ? 1.320 1.529 -0.209 0.026 N 345 18 CA A THR 101 ? ? CB A THR 101 ? ? 1.316 1.529 -0.213 0.026 N 346 18 CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 347 18 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.327 1.543 -0.216 0.021 N 348 18 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 349 18 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.335 1.543 -0.208 0.021 N 350 18 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.328 1.543 -0.215 0.021 N 351 18 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.333 1.543 -0.210 0.021 N 352 19 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.339 1.544 -0.205 0.023 N 353 19 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.326 1.544 -0.218 0.023 N 354 19 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.454 1.252 0.202 0.011 N 355 19 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.327 1.544 -0.217 0.023 N 356 19 CA A THR 50 ? ? CB A THR 50 ? ? 1.334 1.529 -0.195 0.026 N 357 19 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.326 1.543 -0.217 0.021 N 358 19 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.329 1.544 -0.215 0.023 N 359 19 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.334 1.543 -0.209 0.021 N 360 19 CA A THR 70 ? ? CB A THR 70 ? ? 1.314 1.529 -0.215 0.026 N 361 19 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.327 1.543 -0.216 0.021 N 362 19 CA A THR 90 ? ? CB A THR 90 ? ? 1.331 1.529 -0.198 0.026 N 363 19 CA A THR 95 ? ? CB A THR 95 ? ? 1.323 1.529 -0.206 0.026 N 364 19 CA A THR 101 ? ? CB A THR 101 ? ? 1.319 1.529 -0.210 0.026 N 365 19 CA A THR 103 ? ? CB A THR 103 ? ? 1.324 1.529 -0.205 0.026 N 366 19 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.327 1.543 -0.216 0.021 N 367 19 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.323 1.543 -0.220 0.021 N 368 19 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.338 1.543 -0.205 0.021 N 369 19 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 370 19 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.328 1.543 -0.215 0.021 N 371 20 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.334 1.544 -0.210 0.023 N 372 20 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.324 1.544 -0.220 0.023 N 373 20 CE1 A TYR 42 ? ? CZ A TYR 42 ? ? 1.224 1.381 -0.157 0.013 N 374 20 CZ A TYR 42 ? ? CE2 A TYR 42 ? ? 1.528 1.381 0.147 0.013 N 375 20 CD A GLU 46 ? ? OE2 A GLU 46 ? ? 1.455 1.252 0.203 0.011 N 376 20 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.329 1.544 -0.215 0.023 N 377 20 CA A THR 50 ? ? CB A THR 50 ? ? 1.335 1.529 -0.194 0.026 N 378 20 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.321 1.543 -0.222 0.021 N 379 20 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.324 1.544 -0.220 0.023 N 380 20 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.329 1.543 -0.214 0.021 N 381 20 CA A THR 70 ? ? CB A THR 70 ? ? 1.318 1.529 -0.211 0.026 N 382 20 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.329 1.543 -0.214 0.021 N 383 20 CA A THR 90 ? ? CB A THR 90 ? ? 1.324 1.529 -0.205 0.026 N 384 20 CA A THR 95 ? ? CB A THR 95 ? ? 1.336 1.529 -0.193 0.026 N 385 20 CA A THR 101 ? ? CB A THR 101 ? ? 1.320 1.529 -0.209 0.026 N 386 20 CA A THR 103 ? ? CB A THR 103 ? ? 1.325 1.529 -0.204 0.026 N 387 20 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.331 1.543 -0.212 0.021 N 388 20 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.336 1.543 -0.207 0.021 N 389 20 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.331 1.543 -0.212 0.021 N 390 20 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.331 1.543 -0.212 0.021 N 391 20 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.327 1.543 -0.216 0.021 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 40 ? ? -106.52 -68.40 2 1 LYS A 64 ? ? -134.65 -45.57 3 1 ALA A 67 ? ? 173.29 74.77 4 1 PHE A 75 ? ? -106.29 -69.43 5 1 SER A 85 ? ? -83.94 -77.94 6 1 ASN A 89 ? ? -166.15 94.12 7 1 ASP A 97 ? ? -143.66 -156.93 8 1 TYR A 98 ? ? 73.52 -24.85 9 1 GLN A 99 ? ? -158.74 -38.02 10 1 PRO A 102 ? ? -48.59 87.48 11 1 ASP A 116 ? ? -64.27 89.80 12 1 SER A 117 ? ? -177.13 -170.02 13 2 ALA A 27 ? ? -148.75 -82.26 14 2 ILE A 49 ? ? -96.07 -69.17 15 2 LYS A 55 ? ? 83.96 7.17 16 2 LYS A 64 ? ? -136.30 -62.55 17 2 ALA A 67 ? ? 171.97 88.18 18 2 PHE A 75 ? ? -134.73 -74.33 19 2 SER A 85 ? ? -90.74 -72.30 20 2 ASN A 89 ? ? -169.68 110.23 21 2 ASP A 97 ? ? -123.20 -147.05 22 2 TYR A 98 ? ? 65.87 -85.36 23 2 PRO A 102 ? ? -20.25 92.86 24 2 ASP A 116 ? ? -163.70 83.90 25 3 PHE A 28 ? ? -31.90 150.68 26 3 LEU A 40 ? ? -122.67 -71.94 27 3 ASN A 43 ? ? -125.05 -167.93 28 3 THR A 50 ? ? -11.22 105.78 29 3 LYS A 64 ? ? -137.54 -53.16 30 3 ALA A 67 ? ? 175.46 87.11 31 3 PHE A 75 ? ? -106.75 -80.74 32 3 GLN A 99 ? ? 75.51 -43.25 33 3 PRO A 102 ? ? -36.50 91.29 34 3 LEU A 113 ? ? -92.11 -93.94 35 3 ASP A 116 ? ? 63.94 87.44 36 3 SER A 117 ? ? -173.74 -176.42 37 4 THR A 50 ? ? -140.08 -41.38 38 4 LYS A 64 ? ? -135.30 -38.47 39 4 ASP A 65 ? ? -90.43 -87.56 40 4 ALA A 67 ? ? -171.77 86.23 41 4 ASP A 71 ? ? -51.89 108.54 42 4 PHE A 75 ? ? -127.30 -70.59 43 4 SER A 85 ? ? -74.04 -86.05 44 4 ASN A 89 ? ? -164.41 58.03 45 4 ASP A 97 ? ? -133.92 -152.46 46 4 TYR A 98 ? ? 71.41 -68.10 47 4 PRO A 102 ? ? -48.10 90.69 48 4 ALA A 112 ? ? -177.80 93.67 49 4 LEU A 113 ? ? 177.68 86.65 50 4 ASP A 116 ? ? -140.02 35.29 51 5 ALA A 27 ? ? -159.70 78.24 52 5 PHE A 28 ? ? 55.76 -152.33 53 5 ALA A 44 ? ? 75.72 -42.34 54 5 LYS A 64 ? ? -121.84 -51.65 55 5 ASP A 65 ? ? -74.89 -78.34 56 5 ALA A 67 ? ? -168.99 77.20 57 5 THR A 70 ? ? -136.58 -44.34 58 5 PHE A 75 ? ? -124.77 -70.82 59 5 SER A 85 ? ? -96.41 -77.57 60 5 TYR A 98 ? ? -179.91 -74.49 61 5 PRO A 102 ? ? -54.74 84.75 62 6 PHE A 28 ? ? 69.65 142.34 63 6 LEU A 40 ? ? -129.82 -67.46 64 6 ASN A 43 ? ? 63.23 172.89 65 6 ALA A 45 ? ? -92.51 -63.78 66 6 ARG A 52 ? ? 71.57 99.29 67 6 LYS A 64 ? ? -148.66 -49.16 68 6 VAL A 66 ? ? -149.58 14.02 69 6 ALA A 67 ? ? -171.25 94.52 70 6 PHE A 75 ? ? -107.46 -72.12 71 6 SER A 85 ? ? -167.11 29.23 72 6 ASN A 87 ? ? 63.77 124.77 73 6 ASN A 89 ? ? -165.03 104.68 74 6 ASP A 97 ? ? -124.54 -158.53 75 6 TYR A 98 ? ? 70.96 -74.64 76 6 PRO A 102 ? ? -52.90 86.58 77 6 ASP A 116 ? ? -56.92 100.14 78 7 PHE A 28 ? ? 64.88 168.04 79 7 VAL A 57 ? ? -89.91 45.33 80 7 ALA A 67 ? ? 179.81 74.58 81 7 ASP A 71 ? ? -59.96 102.79 82 7 SER A 85 ? ? -65.95 -71.15 83 7 ASN A 89 ? ? -163.80 47.00 84 7 TYR A 98 ? ? 174.24 -71.17 85 7 PRO A 102 ? ? -51.40 90.90 86 7 LEU A 113 ? ? -87.72 32.71 87 7 ASP A 116 ? ? 60.21 77.25 88 8 PHE A 28 ? ? 173.01 170.90 89 8 LEU A 40 ? ? -96.93 -75.47 90 8 LYS A 64 ? ? -143.18 -42.43 91 8 ASP A 65 ? ? -95.15 -77.02 92 8 ALA A 67 ? ? -165.25 86.23 93 8 PHE A 75 ? ? -124.50 -74.17 94 8 SER A 85 ? ? -101.26 -77.13 95 8 ASN A 89 ? ? -176.11 116.53 96 8 ASP A 97 ? ? 170.52 144.82 97 8 THR A 101 ? ? -58.87 100.92 98 8 PRO A 102 ? ? -39.55 99.97 99 9 ALA A 27 ? ? -80.12 -77.03 100 9 LEU A 40 ? ? -118.19 -86.43 101 9 GLN A 56 ? ? -97.82 -60.52 102 9 VAL A 57 ? ? -88.27 40.12 103 9 LYS A 64 ? ? -158.79 -46.74 104 9 ASP A 65 ? ? -71.28 -78.96 105 9 ALA A 67 ? ? -163.90 81.28 106 9 SER A 72 ? ? 179.81 155.05 107 9 PHE A 75 ? ? -104.34 -72.27 108 9 SER A 85 ? ? -72.26 -70.07 109 9 ASN A 87 ? ? 67.02 107.48 110 9 GLN A 99 ? ? 80.22 -28.43 111 9 PRO A 102 ? ? -61.87 72.08 112 9 ALA A 112 ? ? -134.92 -159.19 113 9 SER A 114 ? ? 67.28 65.48 114 9 ASP A 116 ? ? 50.33 80.09 115 10 ALA A 27 ? ? -174.30 -76.10 116 10 LEU A 40 ? ? -101.93 -63.74 117 10 ALA A 44 ? ? 71.47 -15.54 118 10 ILE A 49 ? ? -83.82 -72.27 119 10 THR A 50 ? ? -173.73 43.24 120 10 LYS A 64 ? ? -147.16 -45.52 121 10 ASP A 65 ? ? -71.55 -78.80 122 10 ALA A 67 ? ? -158.07 71.82 123 10 PHE A 75 ? ? -134.94 -73.99 124 10 SER A 85 ? ? -98.02 -74.58 125 10 PRO A 102 ? ? -31.65 86.78 126 10 LEU A 113 ? ? -84.42 -94.97 127 10 ASP A 116 ? ? 64.43 64.17 128 11 ALA A 27 ? ? -102.67 -70.89 129 11 LEU A 40 ? ? -107.13 -66.48 130 11 ILE A 49 ? ? -80.55 -72.10 131 11 LYS A 55 ? ? 81.49 11.20 132 11 LYS A 64 ? ? -136.45 -63.47 133 11 ALA A 67 ? ? 171.06 85.71 134 11 PHE A 75 ? ? -141.58 -71.67 135 11 SER A 85 ? ? -66.33 -77.25 136 11 ASN A 89 ? ? -175.68 91.86 137 11 PRO A 102 ? ? -54.17 88.62 138 11 LEU A 113 ? ? -107.50 -164.66 139 12 PHE A 28 ? ? 64.37 -172.08 140 12 LEU A 40 ? ? -107.44 -80.98 141 12 VAL A 57 ? ? -93.38 -93.87 142 12 ILE A 58 ? ? 54.31 99.42 143 12 PHE A 63 ? ? -82.69 30.54 144 12 LYS A 64 ? ? -161.85 -42.40 145 12 ASP A 65 ? ? -79.94 -78.26 146 12 ALA A 67 ? ? -177.76 94.62 147 12 ASP A 71 ? ? -62.20 96.35 148 12 SER A 72 ? ? 175.79 158.00 149 12 PHE A 75 ? ? -96.09 -69.13 150 12 SER A 85 ? ? -100.53 -73.32 151 12 ASN A 89 ? ? -172.15 116.15 152 12 TYR A 98 ? ? -175.76 -79.05 153 12 PRO A 102 ? ? -49.47 87.26 154 12 LEU A 113 ? ? -110.91 -168.19 155 12 SER A 114 ? ? 75.15 72.86 156 12 ASP A 116 ? ? 55.03 80.81 157 13 ALA A 27 ? ? -157.12 -48.97 158 13 THR A 50 ? ? -36.32 90.50 159 13 LYS A 64 ? ? -124.54 -61.95 160 13 ALA A 67 ? ? 167.27 79.57 161 13 ASP A 71 ? ? -63.75 99.23 162 13 SER A 85 ? ? -88.67 -73.20 163 13 ASP A 97 ? ? -113.23 -131.37 164 13 TYR A 98 ? ? 70.65 -70.23 165 13 PRO A 102 ? ? -62.84 72.16 166 13 ALA A 112 ? ? -172.21 -160.76 167 13 LEU A 113 ? ? 33.62 111.45 168 13 SER A 114 ? ? -18.23 99.09 169 14 ALA A 27 ? ? -168.48 -67.28 170 14 LEU A 40 ? ? -127.98 -80.46 171 14 ASN A 43 ? ? 61.92 -173.92 172 14 PHE A 63 ? ? -79.76 21.96 173 14 LYS A 64 ? ? -149.92 -49.67 174 14 ASP A 65 ? ? -87.19 -76.75 175 14 ALA A 67 ? ? -171.41 96.12 176 14 ASP A 71 ? ? -68.69 91.27 177 14 PHE A 75 ? ? -105.57 -67.90 178 14 SER A 85 ? ? -73.52 -70.99 179 14 GLN A 99 ? ? -144.18 -44.77 180 14 PRO A 102 ? ? -59.74 80.46 181 14 ALA A 112 ? ? -176.12 108.77 182 14 LEU A 113 ? ? 168.04 -109.29 183 14 ASP A 116 ? ? -93.11 31.10 184 15 ALA A 27 ? ? -126.39 -57.89 185 15 ALA A 30 ? ? -162.66 112.20 186 15 LYS A 64 ? ? -149.48 -56.42 187 15 ASP A 65 ? ? -89.80 -77.74 188 15 ALA A 67 ? ? -176.85 97.23 189 15 SER A 72 ? ? -177.18 143.85 190 15 PHE A 75 ? ? -142.71 -74.33 191 15 SER A 85 ? ? -76.69 -83.42 192 15 ASN A 89 ? ? -160.99 58.32 193 15 PRO A 102 ? ? -49.10 89.46 194 15 LEU A 113 ? ? -92.40 -98.21 195 15 ASP A 116 ? ? 63.76 86.22 196 16 PHE A 28 ? ? 65.17 136.67 197 16 LEU A 40 ? ? -120.30 -62.68 198 16 LYS A 64 ? ? -141.03 -47.32 199 16 ALA A 67 ? ? 170.84 86.44 200 16 PRO A 68 ? ? -96.00 35.92 201 16 THR A 70 ? ? -130.14 -44.49 202 16 GLU A 74 ? ? -69.86 -91.84 203 16 SER A 85 ? ? -77.38 -71.54 204 16 ASN A 89 ? ? -164.01 47.94 205 16 ASP A 97 ? ? -143.30 -159.75 206 16 TYR A 98 ? ? 69.50 -76.94 207 16 PRO A 102 ? ? -43.51 91.19 208 16 SER A 114 ? ? -141.51 26.60 209 16 ASP A 116 ? ? 55.93 75.29 210 17 ALA A 27 ? ? -126.03 -90.24 211 17 LEU A 40 ? ? -121.19 -72.44 212 17 ALA A 44 ? ? 73.41 -22.39 213 17 LYS A 55 ? ? 82.29 5.38 214 17 ASP A 65 ? ? -89.14 -79.26 215 17 ALA A 67 ? ? -168.30 69.91 216 17 PRO A 68 ? ? -68.94 11.31 217 17 GLU A 74 ? ? -93.65 -60.03 218 17 SER A 85 ? ? -104.99 -81.25 219 17 ASP A 97 ? ? -143.21 -150.26 220 17 TYR A 98 ? ? 66.30 -82.76 221 17 PRO A 102 ? ? -40.41 90.65 222 17 ASP A 116 ? ? -179.07 84.54 223 18 LEU A 40 ? ? -97.68 -62.59 224 18 ALA A 44 ? ? -78.21 20.66 225 18 ALA A 45 ? ? -97.38 -65.17 226 18 THR A 50 ? ? -155.74 -42.11 227 18 ARG A 52 ? ? 61.15 -176.87 228 18 LYS A 64 ? ? -150.79 -45.01 229 18 ASP A 65 ? ? -101.84 -79.05 230 18 ALA A 67 ? ? -172.64 97.06 231 18 SER A 72 ? ? -170.54 149.79 232 18 SER A 85 ? ? -90.08 -66.70 233 18 ASN A 87 ? ? 65.88 105.62 234 18 ASP A 97 ? ? -121.26 -153.75 235 18 TYR A 98 ? ? 71.43 -73.81 236 18 PRO A 102 ? ? -38.15 93.08 237 19 ALA A 27 ? ? 72.77 -60.43 238 19 THR A 50 ? ? -179.44 131.43 239 19 ARG A 52 ? ? 53.95 79.85 240 19 VAL A 57 ? ? -112.93 58.86 241 19 LYS A 64 ? ? -124.37 -50.77 242 19 ASP A 65 ? ? -85.44 -79.68 243 19 ALA A 67 ? ? -165.93 70.45 244 19 PHE A 75 ? ? -130.05 -67.88 245 19 SER A 85 ? ? -99.14 -81.86 246 19 TYR A 98 ? ? -79.22 -82.61 247 19 PRO A 102 ? ? -42.48 89.30 248 19 ALA A 112 ? ? -174.79 94.10 249 19 LEU A 113 ? ? 177.73 -174.98 250 19 ASP A 116 ? ? -143.32 25.32 251 20 THR A 50 ? ? -144.69 -42.95 252 20 LYS A 64 ? ? -122.23 -58.32 253 20 ASP A 65 ? ? -82.31 -76.98 254 20 ALA A 67 ? ? -169.69 74.03 255 20 ASP A 71 ? ? -67.93 96.00 256 20 PHE A 75 ? ? -112.56 -81.77 257 20 SER A 85 ? ? -93.27 -77.96 258 20 TYR A 98 ? ? -174.20 -80.02 259 20 PRO A 102 ? ? -24.33 91.70 260 20 LEU A 113 ? ? -82.77 -112.30 261 20 ASP A 116 ? ? -178.22 88.38 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 CYS A 69 ? ? THR A 70 ? ? -119.00 2 5 CYS A 69 ? ? THR A 70 ? ? -133.42 3 8 CYS A 69 ? ? THR A 70 ? ? -145.11 4 9 CYS A 69 ? ? THR A 70 ? ? -138.93 5 10 CYS A 69 ? ? THR A 70 ? ? -136.81 6 11 CYS A 69 ? ? THR A 70 ? ? -135.92 7 16 CYS A 69 ? ? THR A 70 ? ? -136.75 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 2 CYS A 69 ? ? -14.48 2 3 CYS A 69 ? ? -10.18 3 4 CYS A 69 ? ? -12.54 4 8 CYS A 69 ? ? -10.97 5 13 CYS A 69 ? ? -11.88 6 15 CYS A 69 ? ? -10.54 7 16 CYS A 69 ? ? -11.29 8 19 CYS A 69 ? ? -13.82 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 TYR A 118 ? ? 0.070 'SIDE CHAIN' 2 5 TYR A 118 ? ? 0.053 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 13 ? A HIS 1 2 1 Y 1 A HIS 14 ? A HIS 2 3 1 Y 1 A HIS 15 ? A HIS 3 4 1 Y 1 A HIS 16 ? A HIS 4 5 1 Y 1 A HIS 17 ? A HIS 5 6 1 Y 1 A HIS 18 ? A HIS 6 7 1 Y 1 A GLU 19 ? A GLU 7 8 1 Y 1 A SER 20 ? A SER 8 9 1 Y 1 A ASP 21 ? A ASP 9 10 1 Y 1 A ASP 22 ? A ASP 10 11 1 Y 1 A ASP 23 ? A ASP 11 12 1 Y 1 A ASP 24 ? A ASP 12 13 1 Y 1 A LYS 25 ? A LYS 13 14 2 Y 1 A HIS 13 ? A HIS 1 15 2 Y 1 A HIS 14 ? A HIS 2 16 2 Y 1 A HIS 15 ? A HIS 3 17 2 Y 1 A HIS 16 ? A HIS 4 18 2 Y 1 A HIS 17 ? A HIS 5 19 2 Y 1 A HIS 18 ? A HIS 6 20 2 Y 1 A GLU 19 ? A GLU 7 21 2 Y 1 A SER 20 ? A SER 8 22 2 Y 1 A ASP 21 ? A ASP 9 23 2 Y 1 A ASP 22 ? A ASP 10 24 2 Y 1 A ASP 23 ? A ASP 11 25 2 Y 1 A ASP 24 ? A ASP 12 26 2 Y 1 A LYS 25 ? A LYS 13 27 3 Y 1 A HIS 13 ? A HIS 1 28 3 Y 1 A HIS 14 ? A HIS 2 29 3 Y 1 A HIS 15 ? A HIS 3 30 3 Y 1 A HIS 16 ? A HIS 4 31 3 Y 1 A HIS 17 ? A HIS 5 32 3 Y 1 A HIS 18 ? A HIS 6 33 3 Y 1 A GLU 19 ? A GLU 7 34 3 Y 1 A SER 20 ? A SER 8 35 3 Y 1 A ASP 21 ? A ASP 9 36 3 Y 1 A ASP 22 ? A ASP 10 37 3 Y 1 A ASP 23 ? A ASP 11 38 3 Y 1 A ASP 24 ? A ASP 12 39 3 Y 1 A LYS 25 ? A LYS 13 40 4 Y 1 A HIS 13 ? A HIS 1 41 4 Y 1 A HIS 14 ? A HIS 2 42 4 Y 1 A HIS 15 ? A HIS 3 43 4 Y 1 A HIS 16 ? A HIS 4 44 4 Y 1 A HIS 17 ? A HIS 5 45 4 Y 1 A HIS 18 ? A HIS 6 46 4 Y 1 A GLU 19 ? A GLU 7 47 4 Y 1 A SER 20 ? A SER 8 48 4 Y 1 A ASP 21 ? A ASP 9 49 4 Y 1 A ASP 22 ? A ASP 10 50 4 Y 1 A ASP 23 ? A ASP 11 51 4 Y 1 A ASP 24 ? A ASP 12 52 4 Y 1 A LYS 25 ? A LYS 13 53 5 Y 1 A HIS 13 ? A HIS 1 54 5 Y 1 A HIS 14 ? A HIS 2 55 5 Y 1 A HIS 15 ? A HIS 3 56 5 Y 1 A HIS 16 ? A HIS 4 57 5 Y 1 A HIS 17 ? A HIS 5 58 5 Y 1 A HIS 18 ? A HIS 6 59 5 Y 1 A GLU 19 ? A GLU 7 60 5 Y 1 A SER 20 ? A SER 8 61 5 Y 1 A ASP 21 ? A ASP 9 62 5 Y 1 A ASP 22 ? A ASP 10 63 5 Y 1 A ASP 23 ? A ASP 11 64 5 Y 1 A ASP 24 ? A ASP 12 65 5 Y 1 A LYS 25 ? A LYS 13 66 6 Y 1 A HIS 13 ? A HIS 1 67 6 Y 1 A HIS 14 ? A HIS 2 68 6 Y 1 A HIS 15 ? A HIS 3 69 6 Y 1 A HIS 16 ? A HIS 4 70 6 Y 1 A HIS 17 ? A HIS 5 71 6 Y 1 A HIS 18 ? A HIS 6 72 6 Y 1 A GLU 19 ? A GLU 7 73 6 Y 1 A SER 20 ? A SER 8 74 6 Y 1 A ASP 21 ? A ASP 9 75 6 Y 1 A ASP 22 ? A ASP 10 76 6 Y 1 A ASP 23 ? A ASP 11 77 6 Y 1 A ASP 24 ? A ASP 12 78 6 Y 1 A LYS 25 ? A LYS 13 79 7 Y 1 A HIS 13 ? A HIS 1 80 7 Y 1 A HIS 14 ? A HIS 2 81 7 Y 1 A HIS 15 ? A HIS 3 82 7 Y 1 A HIS 16 ? A HIS 4 83 7 Y 1 A HIS 17 ? A HIS 5 84 7 Y 1 A HIS 18 ? A HIS 6 85 7 Y 1 A GLU 19 ? A GLU 7 86 7 Y 1 A SER 20 ? A SER 8 87 7 Y 1 A ASP 21 ? A ASP 9 88 7 Y 1 A ASP 22 ? A ASP 10 89 7 Y 1 A ASP 23 ? A ASP 11 90 7 Y 1 A ASP 24 ? A ASP 12 91 7 Y 1 A LYS 25 ? A LYS 13 92 8 Y 1 A HIS 13 ? A HIS 1 93 8 Y 1 A HIS 14 ? A HIS 2 94 8 Y 1 A HIS 15 ? A HIS 3 95 8 Y 1 A HIS 16 ? A HIS 4 96 8 Y 1 A HIS 17 ? A HIS 5 97 8 Y 1 A HIS 18 ? A HIS 6 98 8 Y 1 A GLU 19 ? A GLU 7 99 8 Y 1 A SER 20 ? A SER 8 100 8 Y 1 A ASP 21 ? A ASP 9 101 8 Y 1 A ASP 22 ? A ASP 10 102 8 Y 1 A ASP 23 ? A ASP 11 103 8 Y 1 A ASP 24 ? A ASP 12 104 8 Y 1 A LYS 25 ? A LYS 13 105 9 Y 1 A HIS 13 ? A HIS 1 106 9 Y 1 A HIS 14 ? A HIS 2 107 9 Y 1 A HIS 15 ? A HIS 3 108 9 Y 1 A HIS 16 ? A HIS 4 109 9 Y 1 A HIS 17 ? A HIS 5 110 9 Y 1 A HIS 18 ? A HIS 6 111 9 Y 1 A GLU 19 ? A GLU 7 112 9 Y 1 A SER 20 ? A SER 8 113 9 Y 1 A ASP 21 ? A ASP 9 114 9 Y 1 A ASP 22 ? A ASP 10 115 9 Y 1 A ASP 23 ? A ASP 11 116 9 Y 1 A ASP 24 ? A ASP 12 117 9 Y 1 A LYS 25 ? A LYS 13 118 10 Y 1 A HIS 13 ? A HIS 1 119 10 Y 1 A HIS 14 ? A HIS 2 120 10 Y 1 A HIS 15 ? A HIS 3 121 10 Y 1 A HIS 16 ? A HIS 4 122 10 Y 1 A HIS 17 ? A HIS 5 123 10 Y 1 A HIS 18 ? A HIS 6 124 10 Y 1 A GLU 19 ? A GLU 7 125 10 Y 1 A SER 20 ? A SER 8 126 10 Y 1 A ASP 21 ? A ASP 9 127 10 Y 1 A ASP 22 ? A ASP 10 128 10 Y 1 A ASP 23 ? A ASP 11 129 10 Y 1 A ASP 24 ? A ASP 12 130 10 Y 1 A LYS 25 ? A LYS 13 131 11 Y 1 A HIS 13 ? A HIS 1 132 11 Y 1 A HIS 14 ? A HIS 2 133 11 Y 1 A HIS 15 ? A HIS 3 134 11 Y 1 A HIS 16 ? A HIS 4 135 11 Y 1 A HIS 17 ? A HIS 5 136 11 Y 1 A HIS 18 ? A HIS 6 137 11 Y 1 A GLU 19 ? A GLU 7 138 11 Y 1 A SER 20 ? A SER 8 139 11 Y 1 A ASP 21 ? A ASP 9 140 11 Y 1 A ASP 22 ? A ASP 10 141 11 Y 1 A ASP 23 ? A ASP 11 142 11 Y 1 A ASP 24 ? A ASP 12 143 11 Y 1 A LYS 25 ? A LYS 13 144 12 Y 1 A HIS 13 ? A HIS 1 145 12 Y 1 A HIS 14 ? A HIS 2 146 12 Y 1 A HIS 15 ? A HIS 3 147 12 Y 1 A HIS 16 ? A HIS 4 148 12 Y 1 A HIS 17 ? A HIS 5 149 12 Y 1 A HIS 18 ? A HIS 6 150 12 Y 1 A GLU 19 ? A GLU 7 151 12 Y 1 A SER 20 ? A SER 8 152 12 Y 1 A ASP 21 ? A ASP 9 153 12 Y 1 A ASP 22 ? A ASP 10 154 12 Y 1 A ASP 23 ? A ASP 11 155 12 Y 1 A ASP 24 ? A ASP 12 156 12 Y 1 A LYS 25 ? A LYS 13 157 13 Y 1 A HIS 13 ? A HIS 1 158 13 Y 1 A HIS 14 ? A HIS 2 159 13 Y 1 A HIS 15 ? A HIS 3 160 13 Y 1 A HIS 16 ? A HIS 4 161 13 Y 1 A HIS 17 ? A HIS 5 162 13 Y 1 A HIS 18 ? A HIS 6 163 13 Y 1 A GLU 19 ? A GLU 7 164 13 Y 1 A SER 20 ? A SER 8 165 13 Y 1 A ASP 21 ? A ASP 9 166 13 Y 1 A ASP 22 ? A ASP 10 167 13 Y 1 A ASP 23 ? A ASP 11 168 13 Y 1 A ASP 24 ? A ASP 12 169 13 Y 1 A LYS 25 ? A LYS 13 170 14 Y 1 A HIS 13 ? A HIS 1 171 14 Y 1 A HIS 14 ? A HIS 2 172 14 Y 1 A HIS 15 ? A HIS 3 173 14 Y 1 A HIS 16 ? A HIS 4 174 14 Y 1 A HIS 17 ? A HIS 5 175 14 Y 1 A HIS 18 ? A HIS 6 176 14 Y 1 A GLU 19 ? A GLU 7 177 14 Y 1 A SER 20 ? A SER 8 178 14 Y 1 A ASP 21 ? A ASP 9 179 14 Y 1 A ASP 22 ? A ASP 10 180 14 Y 1 A ASP 23 ? A ASP 11 181 14 Y 1 A ASP 24 ? A ASP 12 182 14 Y 1 A LYS 25 ? A LYS 13 183 15 Y 1 A HIS 13 ? A HIS 1 184 15 Y 1 A HIS 14 ? A HIS 2 185 15 Y 1 A HIS 15 ? A HIS 3 186 15 Y 1 A HIS 16 ? A HIS 4 187 15 Y 1 A HIS 17 ? A HIS 5 188 15 Y 1 A HIS 18 ? A HIS 6 189 15 Y 1 A GLU 19 ? A GLU 7 190 15 Y 1 A SER 20 ? A SER 8 191 15 Y 1 A ASP 21 ? A ASP 9 192 15 Y 1 A ASP 22 ? A ASP 10 193 15 Y 1 A ASP 23 ? A ASP 11 194 15 Y 1 A ASP 24 ? A ASP 12 195 15 Y 1 A LYS 25 ? A LYS 13 196 16 Y 1 A HIS 13 ? A HIS 1 197 16 Y 1 A HIS 14 ? A HIS 2 198 16 Y 1 A HIS 15 ? A HIS 3 199 16 Y 1 A HIS 16 ? A HIS 4 200 16 Y 1 A HIS 17 ? A HIS 5 201 16 Y 1 A HIS 18 ? A HIS 6 202 16 Y 1 A GLU 19 ? A GLU 7 203 16 Y 1 A SER 20 ? A SER 8 204 16 Y 1 A ASP 21 ? A ASP 9 205 16 Y 1 A ASP 22 ? A ASP 10 206 16 Y 1 A ASP 23 ? A ASP 11 207 16 Y 1 A ASP 24 ? A ASP 12 208 16 Y 1 A LYS 25 ? A LYS 13 209 17 Y 1 A HIS 13 ? A HIS 1 210 17 Y 1 A HIS 14 ? A HIS 2 211 17 Y 1 A HIS 15 ? A HIS 3 212 17 Y 1 A HIS 16 ? A HIS 4 213 17 Y 1 A HIS 17 ? A HIS 5 214 17 Y 1 A HIS 18 ? A HIS 6 215 17 Y 1 A GLU 19 ? A GLU 7 216 17 Y 1 A SER 20 ? A SER 8 217 17 Y 1 A ASP 21 ? A ASP 9 218 17 Y 1 A ASP 22 ? A ASP 10 219 17 Y 1 A ASP 23 ? A ASP 11 220 17 Y 1 A ASP 24 ? A ASP 12 221 17 Y 1 A LYS 25 ? A LYS 13 222 18 Y 1 A HIS 13 ? A HIS 1 223 18 Y 1 A HIS 14 ? A HIS 2 224 18 Y 1 A HIS 15 ? A HIS 3 225 18 Y 1 A HIS 16 ? A HIS 4 226 18 Y 1 A HIS 17 ? A HIS 5 227 18 Y 1 A HIS 18 ? A HIS 6 228 18 Y 1 A GLU 19 ? A GLU 7 229 18 Y 1 A SER 20 ? A SER 8 230 18 Y 1 A ASP 21 ? A ASP 9 231 18 Y 1 A ASP 22 ? A ASP 10 232 18 Y 1 A ASP 23 ? A ASP 11 233 18 Y 1 A ASP 24 ? A ASP 12 234 18 Y 1 A LYS 25 ? A LYS 13 235 19 Y 1 A HIS 13 ? A HIS 1 236 19 Y 1 A HIS 14 ? A HIS 2 237 19 Y 1 A HIS 15 ? A HIS 3 238 19 Y 1 A HIS 16 ? A HIS 4 239 19 Y 1 A HIS 17 ? A HIS 5 240 19 Y 1 A HIS 18 ? A HIS 6 241 19 Y 1 A GLU 19 ? A GLU 7 242 19 Y 1 A SER 20 ? A SER 8 243 19 Y 1 A ASP 21 ? A ASP 9 244 19 Y 1 A ASP 22 ? A ASP 10 245 19 Y 1 A ASP 23 ? A ASP 11 246 19 Y 1 A ASP 24 ? A ASP 12 247 19 Y 1 A LYS 25 ? A LYS 13 248 20 Y 1 A HIS 13 ? A HIS 1 249 20 Y 1 A HIS 14 ? A HIS 2 250 20 Y 1 A HIS 15 ? A HIS 3 251 20 Y 1 A HIS 16 ? A HIS 4 252 20 Y 1 A HIS 17 ? A HIS 5 253 20 Y 1 A HIS 18 ? A HIS 6 254 20 Y 1 A GLU 19 ? A GLU 7 255 20 Y 1 A SER 20 ? A SER 8 256 20 Y 1 A ASP 21 ? A ASP 9 257 20 Y 1 A ASP 22 ? A ASP 10 258 20 Y 1 A ASP 23 ? A ASP 11 259 20 Y 1 A ASP 24 ? A ASP 12 260 20 Y 1 A LYS 25 ? A LYS 13 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;4'-HYDROXYCINNAMIC ACID ; _pdbx_entity_nonpoly.comp_id HC4 #