data_1XFQ # _entry.id 1XFQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XFQ pdb_00001xfq 10.2210/pdb1xfq/pdb RCSB RCSB030311 ? ? WWPDB D_1000030311 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1XFN _pdbx_database_related.details 'NMR structure of the ground state' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XFQ _pdbx_database_status.recvd_initial_deposition_date 2004-09-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bernard, C.' 1 'Houben, K.' 2 'Derix, N.M.' 3 'Marks, D.' 4 'van der Horst, M.A.' 5 'Hellingwerf, K.J.' 6 'Boelens, R.' 7 'Kaptein, R.' 8 'van Nuland, N.A.' 9 # _citation.id primary _citation.title 'The solution structure of a transient photoreceptor intermediate: delta25 photoactive yellow protein' _citation.journal_abbrev STRUCTURE _citation.journal_volume 13 _citation.page_first 953 _citation.page_last 962 _citation.year 2005 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16004868 _citation.pdbx_database_id_DOI 10.1016/j.str.2005.04.017 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bernard, C.' 1 ? primary 'Houben, K.' 2 ? primary 'Derix, N.M.' 3 ? primary 'Marks, D.' 4 ? primary 'van der Horst, M.A.' 5 ? primary 'Hellingwerf, K.J.' 6 ? primary 'Boelens, R.' 7 ? primary 'Kaptein, R.' 8 ? primary 'van Nuland, N.A.' 9 ? # _cell.entry_id 1XFQ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XFQ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Photoactive yellow protein' 12816.266 1 ? ? 'residues 26-125' ? 2 non-polymer syn ;4'-HYDROXYCINNAMIC ACID ; 164.158 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PYP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHESDDDDKLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMF EYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHESDDDDKLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMF EYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 GLU n 1 8 SER n 1 9 ASP n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 LYS n 1 14 LEU n 1 15 ALA n 1 16 PHE n 1 17 GLY n 1 18 ALA n 1 19 ILE n 1 20 GLN n 1 21 LEU n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLY n 1 26 ASN n 1 27 ILE n 1 28 LEU n 1 29 GLN n 1 30 TYR n 1 31 ASN n 1 32 ALA n 1 33 ALA n 1 34 GLU n 1 35 GLY n 1 36 ASP n 1 37 ILE n 1 38 THR n 1 39 GLY n 1 40 ARG n 1 41 ASP n 1 42 PRO n 1 43 LYS n 1 44 GLN n 1 45 VAL n 1 46 ILE n 1 47 GLY n 1 48 LYS n 1 49 ASN n 1 50 PHE n 1 51 PHE n 1 52 LYS n 1 53 ASP n 1 54 VAL n 1 55 ALA n 1 56 PRO n 1 57 CYS n 1 58 THR n 1 59 ASP n 1 60 SER n 1 61 PRO n 1 62 GLU n 1 63 PHE n 1 64 TYR n 1 65 GLY n 1 66 LYS n 1 67 PHE n 1 68 LYS n 1 69 GLU n 1 70 GLY n 1 71 VAL n 1 72 ALA n 1 73 SER n 1 74 GLY n 1 75 ASN n 1 76 LEU n 1 77 ASN n 1 78 THR n 1 79 MET n 1 80 PHE n 1 81 GLU n 1 82 TYR n 1 83 THR n 1 84 PHE n 1 85 ASP n 1 86 TYR n 1 87 GLN n 1 88 MET n 1 89 THR n 1 90 PRO n 1 91 THR n 1 92 LYS n 1 93 VAL n 1 94 LYS n 1 95 VAL n 1 96 HIS n 1 97 MET n 1 98 LYS n 1 99 LYS n 1 100 ALA n 1 101 LEU n 1 102 SER n 1 103 GLY n 1 104 ASP n 1 105 SER n 1 106 TYR n 1 107 TRP n 1 108 VAL n 1 109 PHE n 1 110 VAL n 1 111 LYS n 1 112 ARG n 1 113 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Halorhodospira _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halorhodospira halophila' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1053 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PYP_ECTHA _struct_ref.pdbx_db_accession P16113 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKV KVHMKKALSGDSYWVFVKRV ; _struct_ref.pdbx_align_begin 26 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XFQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16113 _struct_ref_seq.db_align_beg 26 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 26 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1XFQ HIS A 1 ? UNP P16113 ? ? 'expression tag' 13 1 1 1XFQ HIS A 2 ? UNP P16113 ? ? 'expression tag' 14 2 1 1XFQ HIS A 3 ? UNP P16113 ? ? 'expression tag' 15 3 1 1XFQ HIS A 4 ? UNP P16113 ? ? 'expression tag' 16 4 1 1XFQ HIS A 5 ? UNP P16113 ? ? 'expression tag' 17 5 1 1XFQ HIS A 6 ? UNP P16113 ? ? 'expression tag' 18 6 1 1XFQ GLU A 7 ? UNP P16113 ? ? 'expression tag' 19 7 1 1XFQ SER A 8 ? UNP P16113 ? ? 'expression tag' 20 8 1 1XFQ ASP A 9 ? UNP P16113 ? ? 'expression tag' 21 9 1 1XFQ ASP A 10 ? UNP P16113 ? ? 'expression tag' 22 10 1 1XFQ ASP A 11 ? UNP P16113 ? ? 'expression tag' 23 11 1 1XFQ ASP A 12 ? UNP P16113 ? ? 'expression tag' 24 12 1 1XFQ LYS A 13 ? UNP P16113 ? ? 'expression tag' 25 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HC4 non-polymer . ;4'-HYDROXYCINNAMIC ACID ; 'PARA-COUMARIC ACID' 'C9 H8 O3' 164.158 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 HNCA 2 1 1 'CBCA(CO)NH' 3 2 1 '3D 15N TOCSY-HSQC' 4 2 1 3D_15N-separated_NOESY 5 2 1 '2D NOESY' 6 2 1 '2D TOCSY' 7 1 1 HNCO 8 1 1 HNCACB 9 1 1 '13C filtered 2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM Delta25-PYP, 15N-13C, 50mM phosphate buffer' '90% H2O/10% D2O' 2 '1mM Delta25-PYP 15N, 50mM phosphate buffer' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 900 2 ? Bruker AVANCE 750 3 ? Bruker AVANCE 500 # _pdbx_nmr_refine.entry_id 1XFQ _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1XFQ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1XFQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.1 collection bruker 1 NMRPipe ? processing johnson 2 NMRView 5.0.4 'data analysis' Delaglio 3 CNS 1.2 'structure solution' Brunger 4 CNS 1.2 refinement Brunger 5 # _exptl.entry_id 1XFQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1XFQ _struct.title 'structure of the blue shifted intermediate state of the photoactive yellow protein lacking the N-terminal part' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XFQ _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'PAS DOMAIN, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 66 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 74 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 78 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 86 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 57 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id HC4 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 69 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id HC4 _struct_conn.ptnr2_auth_seq_id 169 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.819 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 27 ? ASN A 31 ? ILE A 39 ASN A 43 A 2 ALA A 18 ? ASP A 22 ? ALA A 30 ASP A 34 A 3 SER A 105 ? ARG A 112 ? SER A 117 ARG A 124 A 4 VAL A 93 ? LYS A 99 ? VAL A 105 LYS A 111 A 5 THR A 78 ? TYR A 82 ? THR A 90 TYR A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASN A 31 ? O ASN A 43 N ALA A 18 ? N ALA A 30 A 2 3 N ILE A 19 ? N ILE A 31 O VAL A 108 ? O VAL A 120 A 3 4 O TRP A 107 ? O TRP A 119 N LYS A 98 ? N LYS A 110 A 4 5 O VAL A 95 ? O VAL A 107 N PHE A 80 ? N PHE A 92 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HC4 _struct_site.pdbx_auth_seq_id 169 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE HC4 A 169' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id CYS _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 57 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id CYS _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 69 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _database_PDB_matrix.entry_id 1XFQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XFQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 13 ? ? ? A . n A 1 2 HIS 2 14 ? ? ? A . n A 1 3 HIS 3 15 ? ? ? A . n A 1 4 HIS 4 16 ? ? ? A . n A 1 5 HIS 5 17 ? ? ? A . n A 1 6 HIS 6 18 ? ? ? A . n A 1 7 GLU 7 19 ? ? ? A . n A 1 8 SER 8 20 ? ? ? A . n A 1 9 ASP 9 21 ? ? ? A . n A 1 10 ASP 10 22 ? ? ? A . n A 1 11 ASP 11 23 ? ? ? A . n A 1 12 ASP 12 24 ? ? ? A . n A 1 13 LYS 13 25 ? ? ? A . n A 1 14 LEU 14 26 26 LEU LEU A . n A 1 15 ALA 15 27 27 ALA ALA A . n A 1 16 PHE 16 28 28 PHE PHE A . n A 1 17 GLY 17 29 29 GLY GLY A . n A 1 18 ALA 18 30 30 ALA ALA A . n A 1 19 ILE 19 31 31 ILE ILE A . n A 1 20 GLN 20 32 32 GLN GLN A . n A 1 21 LEU 21 33 33 LEU LEU A . n A 1 22 ASP 22 34 34 ASP ASP A . n A 1 23 GLY 23 35 35 GLY GLY A . n A 1 24 ASP 24 36 36 ASP ASP A . n A 1 25 GLY 25 37 37 GLY GLY A . n A 1 26 ASN 26 38 38 ASN ASN A . n A 1 27 ILE 27 39 39 ILE ILE A . n A 1 28 LEU 28 40 40 LEU LEU A . n A 1 29 GLN 29 41 41 GLN GLN A . n A 1 30 TYR 30 42 42 TYR TYR A . n A 1 31 ASN 31 43 43 ASN ASN A . n A 1 32 ALA 32 44 44 ALA ALA A . n A 1 33 ALA 33 45 45 ALA ALA A . n A 1 34 GLU 34 46 46 GLU GLU A . n A 1 35 GLY 35 47 47 GLY GLY A . n A 1 36 ASP 36 48 48 ASP ASP A . n A 1 37 ILE 37 49 49 ILE ILE A . n A 1 38 THR 38 50 50 THR THR A . n A 1 39 GLY 39 51 51 GLY GLY A . n A 1 40 ARG 40 52 52 ARG ARG A . n A 1 41 ASP 41 53 53 ASP ASP A . n A 1 42 PRO 42 54 54 PRO PRO A . n A 1 43 LYS 43 55 55 LYS LYS A . n A 1 44 GLN 44 56 56 GLN GLN A . n A 1 45 VAL 45 57 57 VAL VAL A . n A 1 46 ILE 46 58 58 ILE ILE A . n A 1 47 GLY 47 59 59 GLY GLY A . n A 1 48 LYS 48 60 60 LYS LYS A . n A 1 49 ASN 49 61 61 ASN ASN A . n A 1 50 PHE 50 62 62 PHE PHE A . n A 1 51 PHE 51 63 63 PHE PHE A . n A 1 52 LYS 52 64 64 LYS LYS A . n A 1 53 ASP 53 65 65 ASP ASP A . n A 1 54 VAL 54 66 66 VAL VAL A . n A 1 55 ALA 55 67 67 ALA ALA A . n A 1 56 PRO 56 68 68 PRO PRO A . n A 1 57 CYS 57 69 69 CYS CYS A . n A 1 58 THR 58 70 70 THR THR A . n A 1 59 ASP 59 71 71 ASP ASP A . n A 1 60 SER 60 72 72 SER SER A . n A 1 61 PRO 61 73 73 PRO PRO A . n A 1 62 GLU 62 74 74 GLU GLU A . n A 1 63 PHE 63 75 75 PHE PHE A . n A 1 64 TYR 64 76 76 TYR TYR A . n A 1 65 GLY 65 77 77 GLY GLY A . n A 1 66 LYS 66 78 78 LYS LYS A . n A 1 67 PHE 67 79 79 PHE PHE A . n A 1 68 LYS 68 80 80 LYS LYS A . n A 1 69 GLU 69 81 81 GLU GLU A . n A 1 70 GLY 70 82 82 GLY GLY A . n A 1 71 VAL 71 83 83 VAL VAL A . n A 1 72 ALA 72 84 84 ALA ALA A . n A 1 73 SER 73 85 85 SER SER A . n A 1 74 GLY 74 86 86 GLY GLY A . n A 1 75 ASN 75 87 87 ASN ASN A . n A 1 76 LEU 76 88 88 LEU LEU A . n A 1 77 ASN 77 89 89 ASN ASN A . n A 1 78 THR 78 90 90 THR THR A . n A 1 79 MET 79 91 91 MET MET A . n A 1 80 PHE 80 92 92 PHE PHE A . n A 1 81 GLU 81 93 93 GLU GLU A . n A 1 82 TYR 82 94 94 TYR TYR A . n A 1 83 THR 83 95 95 THR THR A . n A 1 84 PHE 84 96 96 PHE PHE A . n A 1 85 ASP 85 97 97 ASP ASP A . n A 1 86 TYR 86 98 98 TYR TYR A . n A 1 87 GLN 87 99 99 GLN GLN A . n A 1 88 MET 88 100 100 MET MET A . n A 1 89 THR 89 101 101 THR THR A . n A 1 90 PRO 90 102 102 PRO PRO A . n A 1 91 THR 91 103 103 THR THR A . n A 1 92 LYS 92 104 104 LYS LYS A . n A 1 93 VAL 93 105 105 VAL VAL A . n A 1 94 LYS 94 106 106 LYS LYS A . n A 1 95 VAL 95 107 107 VAL VAL A . n A 1 96 HIS 96 108 108 HIS HIS A . n A 1 97 MET 97 109 109 MET MET A . n A 1 98 LYS 98 110 110 LYS LYS A . n A 1 99 LYS 99 111 111 LYS LYS A . n A 1 100 ALA 100 112 112 ALA ALA A . n A 1 101 LEU 101 113 113 LEU LEU A . n A 1 102 SER 102 114 114 SER SER A . n A 1 103 GLY 103 115 115 GLY GLY A . n A 1 104 ASP 104 116 116 ASP ASP A . n A 1 105 SER 105 117 117 SER SER A . n A 1 106 TYR 106 118 118 TYR TYR A . n A 1 107 TRP 107 119 119 TRP TRP A . n A 1 108 VAL 108 120 120 VAL VAL A . n A 1 109 PHE 109 121 121 PHE PHE A . n A 1 110 VAL 110 122 122 VAL VAL A . n A 1 111 LYS 111 123 123 LYS LYS A . n A 1 112 ARG 112 124 124 ARG ARG A . n A 1 113 VAL 113 125 125 VAL VAL A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HC4 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 169 _pdbx_nonpoly_scheme.auth_seq_num 169 _pdbx_nonpoly_scheme.pdb_mon_id HC4 _pdbx_nonpoly_scheme.auth_mon_id HC4 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-08-16 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 HA3 A GLY 82 ? ? HG A LEU 88 ? ? 1.34 2 5 HZ1 A LYS 60 ? ? OD2 A ASP 65 ? ? 1.55 3 8 OD2 A ASP 53 ? ? HZ1 A LYS 55 ? ? 1.58 4 10 HA3 A GLY 82 ? ? HG A LEU 88 ? ? 1.31 5 11 HH22 A ARG 52 ? ? HH A TYR 98 ? ? 0.83 6 12 OD2 A ASP 53 ? ? HZ3 A LYS 55 ? ? 1.59 7 13 HA3 A GLY 82 ? ? HG A LEU 88 ? ? 1.34 8 14 HG1 A THR 95 ? ? HH A TYR 98 ? ? 1.23 9 14 OD2 A ASP 53 ? ? HZ2 A LYS 55 ? ? 1.58 10 14 OE1 A GLU 93 ? ? HZ1 A LYS 106 ? ? 1.58 11 16 HA A VAL 83 ? ? HH A TYR 118 ? ? 1.08 12 16 HZ2 A LYS 60 ? ? OE2 A GLU 74 ? ? 1.57 13 18 H A GLY 35 ? ? HA A SER 117 ? ? 1.09 14 19 HG2 A MET 100 ? ? H A THR 101 ? ? 1.33 15 20 O A ASP 116 ? ? HG A SER 117 ? ? 1.57 16 20 OE1 A GLU 93 ? ? HZ1 A LYS 104 ? ? 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.339 1.544 -0.205 0.023 N 2 1 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.328 1.544 -0.216 0.023 N 3 1 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.325 1.544 -0.219 0.023 N 4 1 CA A THR 50 ? ? CB A THR 50 ? ? 1.332 1.529 -0.197 0.026 N 5 1 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.330 1.543 -0.213 0.021 N 6 1 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.339 1.544 -0.205 0.023 N 7 1 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.332 1.543 -0.211 0.021 N 8 1 CA A THR 70 ? ? CB A THR 70 ? ? 1.322 1.529 -0.207 0.026 N 9 1 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 10 1 CA A THR 90 ? ? CB A THR 90 ? ? 1.334 1.529 -0.195 0.026 N 11 1 CA A THR 95 ? ? CB A THR 95 ? ? 1.320 1.529 -0.209 0.026 N 12 1 CA A THR 101 ? ? CB A THR 101 ? ? 1.319 1.529 -0.210 0.026 N 13 1 CA A THR 103 ? ? CB A THR 103 ? ? 1.313 1.529 -0.216 0.026 N 14 1 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.325 1.543 -0.218 0.021 N 15 1 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 16 1 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 17 1 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 18 1 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.327 1.543 -0.216 0.021 N 19 2 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.330 1.544 -0.214 0.023 N 20 2 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.331 1.544 -0.213 0.023 N 21 2 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.332 1.544 -0.212 0.023 N 22 2 CA A THR 50 ? ? CB A THR 50 ? ? 1.320 1.529 -0.209 0.026 N 23 2 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.327 1.543 -0.216 0.021 N 24 2 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.346 1.544 -0.198 0.023 N 25 2 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.331 1.543 -0.212 0.021 N 26 2 CA A THR 70 ? ? CB A THR 70 ? ? 1.333 1.529 -0.196 0.026 N 27 2 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.327 1.543 -0.216 0.021 N 28 2 CA A THR 90 ? ? CB A THR 90 ? ? 1.325 1.529 -0.204 0.026 N 29 2 CA A THR 95 ? ? CB A THR 95 ? ? 1.317 1.529 -0.212 0.026 N 30 2 CA A THR 101 ? ? CB A THR 101 ? ? 1.325 1.529 -0.204 0.026 N 31 2 CA A THR 103 ? ? CB A THR 103 ? ? 1.316 1.529 -0.213 0.026 N 32 2 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.331 1.543 -0.212 0.021 N 33 2 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 34 2 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 35 2 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 36 2 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.330 1.543 -0.213 0.021 N 37 3 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.329 1.544 -0.215 0.023 N 38 3 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.329 1.544 -0.215 0.023 N 39 3 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.336 1.544 -0.208 0.023 N 40 3 CA A THR 50 ? ? CB A THR 50 ? ? 1.321 1.529 -0.208 0.026 N 41 3 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.338 1.543 -0.205 0.021 N 42 3 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.338 1.544 -0.206 0.023 N 43 3 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.336 1.543 -0.207 0.021 N 44 3 CA A THR 70 ? ? CB A THR 70 ? ? 1.318 1.529 -0.211 0.026 N 45 3 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.323 1.543 -0.220 0.021 N 46 3 CA A THR 90 ? ? CB A THR 90 ? ? 1.336 1.529 -0.193 0.026 N 47 3 CA A THR 95 ? ? CB A THR 95 ? ? 1.331 1.529 -0.198 0.026 N 48 3 CA A THR 101 ? ? CB A THR 101 ? ? 1.316 1.529 -0.213 0.026 N 49 3 CA A THR 103 ? ? CB A THR 103 ? ? 1.319 1.529 -0.210 0.026 N 50 3 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.330 1.543 -0.213 0.021 N 51 3 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.330 1.543 -0.213 0.021 N 52 3 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.329 1.543 -0.214 0.021 N 53 3 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 54 3 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.336 1.543 -0.207 0.021 N 55 4 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.340 1.544 -0.204 0.023 N 56 4 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.334 1.544 -0.210 0.023 N 57 4 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.328 1.544 -0.216 0.023 N 58 4 CA A THR 50 ? ? CB A THR 50 ? ? 1.321 1.529 -0.208 0.026 N 59 4 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.341 1.543 -0.202 0.021 N 60 4 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.326 1.544 -0.218 0.023 N 61 4 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.338 1.543 -0.205 0.021 N 62 4 CA A THR 70 ? ? CB A THR 70 ? ? 1.317 1.529 -0.212 0.026 N 63 4 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.322 1.543 -0.221 0.021 N 64 4 CA A THR 90 ? ? CB A THR 90 ? ? 1.335 1.529 -0.194 0.026 N 65 4 CA A THR 95 ? ? CB A THR 95 ? ? 1.322 1.529 -0.207 0.026 N 66 4 CA A THR 101 ? ? CB A THR 101 ? ? 1.318 1.529 -0.211 0.026 N 67 4 CA A THR 103 ? ? CB A THR 103 ? ? 1.326 1.529 -0.203 0.026 N 68 4 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.327 1.543 -0.216 0.021 N 69 4 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.334 1.543 -0.209 0.021 N 70 4 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.331 1.543 -0.212 0.021 N 71 4 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.327 1.543 -0.216 0.021 N 72 4 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.338 1.543 -0.205 0.021 N 73 5 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.330 1.544 -0.214 0.023 N 74 5 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.333 1.544 -0.211 0.023 N 75 5 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.329 1.544 -0.215 0.023 N 76 5 CA A THR 50 ? ? CB A THR 50 ? ? 1.340 1.529 -0.189 0.026 N 77 5 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.336 1.543 -0.207 0.021 N 78 5 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.348 1.544 -0.196 0.023 N 79 5 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.332 1.543 -0.211 0.021 N 80 5 CA A THR 70 ? ? CB A THR 70 ? ? 1.317 1.529 -0.212 0.026 N 81 5 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.323 1.543 -0.220 0.021 N 82 5 CA A THR 90 ? ? CB A THR 90 ? ? 1.323 1.529 -0.206 0.026 N 83 5 CA A THR 95 ? ? CB A THR 95 ? ? 1.319 1.529 -0.210 0.026 N 84 5 CA A THR 101 ? ? CB A THR 101 ? ? 1.329 1.529 -0.200 0.026 N 85 5 CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 86 5 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.330 1.543 -0.213 0.021 N 87 5 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 88 5 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 89 5 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.331 1.543 -0.212 0.021 N 90 5 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.337 1.543 -0.206 0.021 N 91 6 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.334 1.544 -0.210 0.023 N 92 6 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.323 1.544 -0.221 0.023 N 93 6 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.336 1.544 -0.208 0.023 N 94 6 CA A THR 50 ? ? CB A THR 50 ? ? 1.322 1.529 -0.207 0.026 N 95 6 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.327 1.543 -0.216 0.021 N 96 6 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.336 1.544 -0.208 0.023 N 97 6 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.343 1.543 -0.200 0.021 N 98 6 CA A THR 70 ? ? CB A THR 70 ? ? 1.320 1.529 -0.209 0.026 N 99 6 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.328 1.543 -0.215 0.021 N 100 6 CA A THR 90 ? ? CB A THR 90 ? ? 1.330 1.529 -0.199 0.026 N 101 6 CA A THR 95 ? ? CB A THR 95 ? ? 1.318 1.529 -0.211 0.026 N 102 6 CA A THR 101 ? ? CB A THR 101 ? ? 1.325 1.529 -0.204 0.026 N 103 6 CA A THR 103 ? ? CB A THR 103 ? ? 1.320 1.529 -0.209 0.026 N 104 6 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.329 1.543 -0.214 0.021 N 105 6 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 106 6 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 107 6 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 108 6 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.343 1.543 -0.200 0.021 N 109 7 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.339 1.544 -0.205 0.023 N 110 7 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.327 1.544 -0.217 0.023 N 111 7 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.327 1.544 -0.217 0.023 N 112 7 CA A THR 50 ? ? CB A THR 50 ? ? 1.322 1.529 -0.207 0.026 N 113 7 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.339 1.543 -0.204 0.021 N 114 7 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.326 1.544 -0.218 0.023 N 115 7 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.337 1.543 -0.206 0.021 N 116 7 CA A THR 70 ? ? CB A THR 70 ? ? 1.332 1.529 -0.197 0.026 N 117 7 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.323 1.543 -0.220 0.021 N 118 7 CA A THR 90 ? ? CB A THR 90 ? ? 1.331 1.529 -0.198 0.026 N 119 7 CA A THR 95 ? ? CB A THR 95 ? ? 1.318 1.529 -0.211 0.026 N 120 7 CA A THR 101 ? ? CB A THR 101 ? ? 1.318 1.529 -0.211 0.026 N 121 7 CA A THR 103 ? ? CB A THR 103 ? ? 1.320 1.529 -0.209 0.026 N 122 7 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.327 1.543 -0.216 0.021 N 123 7 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.332 1.543 -0.211 0.021 N 124 7 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.330 1.543 -0.213 0.021 N 125 7 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 126 7 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.335 1.543 -0.208 0.021 N 127 8 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.328 1.544 -0.216 0.023 N 128 8 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.331 1.544 -0.213 0.023 N 129 8 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.330 1.544 -0.214 0.023 N 130 8 CA A THR 50 ? ? CB A THR 50 ? ? 1.331 1.529 -0.198 0.026 N 131 8 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.339 1.543 -0.204 0.021 N 132 8 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.337 1.544 -0.207 0.023 N 133 8 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.337 1.543 -0.206 0.021 N 134 8 CA A THR 70 ? ? CB A THR 70 ? ? 1.324 1.529 -0.205 0.026 N 135 8 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.323 1.543 -0.220 0.021 N 136 8 CA A THR 90 ? ? CB A THR 90 ? ? 1.337 1.529 -0.192 0.026 N 137 8 CA A THR 95 ? ? CB A THR 95 ? ? 1.321 1.529 -0.208 0.026 N 138 8 CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 139 8 CA A THR 103 ? ? CB A THR 103 ? ? 1.317 1.529 -0.212 0.026 N 140 8 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 141 8 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.328 1.543 -0.215 0.021 N 142 8 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 143 8 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.336 1.543 -0.207 0.021 N 144 8 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.331 1.543 -0.212 0.021 N 145 9 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.331 1.544 -0.213 0.023 N 146 9 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.321 1.544 -0.223 0.023 N 147 9 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.330 1.544 -0.214 0.023 N 148 9 CA A THR 50 ? ? CB A THR 50 ? ? 1.321 1.529 -0.208 0.026 N 149 9 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.332 1.543 -0.211 0.021 N 150 9 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.329 1.544 -0.215 0.023 N 151 9 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.334 1.543 -0.209 0.021 N 152 9 CA A THR 70 ? ? CB A THR 70 ? ? 1.322 1.529 -0.207 0.026 N 153 9 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 154 9 CA A THR 90 ? ? CB A THR 90 ? ? 1.335 1.529 -0.194 0.026 N 155 9 CA A THR 95 ? ? CB A THR 95 ? ? 1.327 1.529 -0.202 0.026 N 156 9 CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 157 9 CA A THR 103 ? ? CB A THR 103 ? ? 1.315 1.529 -0.214 0.026 N 158 9 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.326 1.543 -0.217 0.021 N 159 9 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.323 1.543 -0.220 0.021 N 160 9 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 161 9 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.328 1.543 -0.215 0.021 N 162 9 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.328 1.543 -0.215 0.021 N 163 10 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.341 1.544 -0.203 0.023 N 164 10 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.328 1.544 -0.216 0.023 N 165 10 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.328 1.544 -0.216 0.023 N 166 10 CA A THR 50 ? ? CB A THR 50 ? ? 1.347 1.529 -0.182 0.026 N 167 10 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.337 1.543 -0.206 0.021 N 168 10 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.339 1.544 -0.205 0.023 N 169 10 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.337 1.543 -0.206 0.021 N 170 10 CA A THR 70 ? ? CB A THR 70 ? ? 1.320 1.529 -0.209 0.026 N 171 10 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.322 1.543 -0.221 0.021 N 172 10 CA A THR 90 ? ? CB A THR 90 ? ? 1.332 1.529 -0.197 0.026 N 173 10 CA A THR 95 ? ? CB A THR 95 ? ? 1.330 1.529 -0.199 0.026 N 174 10 CA A THR 101 ? ? CB A THR 101 ? ? 1.338 1.529 -0.191 0.026 N 175 10 CA A THR 103 ? ? CB A THR 103 ? ? 1.317 1.529 -0.212 0.026 N 176 10 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.326 1.543 -0.217 0.021 N 177 10 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 178 10 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.331 1.543 -0.212 0.021 N 179 10 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 180 10 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.338 1.543 -0.205 0.021 N 181 11 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.328 1.544 -0.216 0.023 N 182 11 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.335 1.544 -0.209 0.023 N 183 11 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.331 1.544 -0.213 0.023 N 184 11 CA A THR 50 ? ? CB A THR 50 ? ? 1.314 1.529 -0.215 0.026 N 185 11 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.331 1.543 -0.212 0.021 N 186 11 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.341 1.544 -0.203 0.023 N 187 11 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.336 1.543 -0.207 0.021 N 188 11 CA A THR 70 ? ? CB A THR 70 ? ? 1.323 1.529 -0.206 0.026 N 189 11 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 190 11 CA A THR 90 ? ? CB A THR 90 ? ? 1.321 1.529 -0.208 0.026 N 191 11 CA A THR 95 ? ? CB A THR 95 ? ? 1.328 1.529 -0.201 0.026 N 192 11 CA A THR 101 ? ? CB A THR 101 ? ? 1.338 1.529 -0.191 0.026 N 193 11 CA A THR 103 ? ? CB A THR 103 ? ? 1.321 1.529 -0.208 0.026 N 194 11 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 195 11 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.330 1.543 -0.213 0.021 N 196 11 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.334 1.543 -0.209 0.021 N 197 11 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.338 1.543 -0.205 0.021 N 198 11 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.326 1.543 -0.217 0.021 N 199 12 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.329 1.544 -0.215 0.023 N 200 12 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.318 1.544 -0.226 0.023 N 201 12 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.333 1.544 -0.211 0.023 N 202 12 CA A THR 50 ? ? CB A THR 50 ? ? 1.327 1.529 -0.202 0.026 N 203 12 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.329 1.543 -0.214 0.021 N 204 12 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.325 1.544 -0.219 0.023 N 205 12 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.338 1.543 -0.205 0.021 N 206 12 CA A THR 70 ? ? CB A THR 70 ? ? 1.316 1.529 -0.213 0.026 N 207 12 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.323 1.543 -0.220 0.021 N 208 12 CA A THR 90 ? ? CB A THR 90 ? ? 1.333 1.529 -0.196 0.026 N 209 12 CA A THR 95 ? ? CB A THR 95 ? ? 1.332 1.529 -0.197 0.026 N 210 12 CA A THR 101 ? ? CB A THR 101 ? ? 1.317 1.529 -0.212 0.026 N 211 12 CA A THR 103 ? ? CB A THR 103 ? ? 1.321 1.529 -0.208 0.026 N 212 12 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 213 12 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.332 1.543 -0.211 0.021 N 214 12 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 215 12 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 216 12 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.338 1.543 -0.205 0.021 N 217 13 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.344 1.544 -0.200 0.023 N 218 13 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.328 1.544 -0.216 0.023 N 219 13 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.327 1.544 -0.217 0.023 N 220 13 CA A THR 50 ? ? CB A THR 50 ? ? 1.333 1.529 -0.196 0.026 N 221 13 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.337 1.543 -0.206 0.021 N 222 13 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.338 1.544 -0.206 0.023 N 223 13 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.336 1.543 -0.207 0.021 N 224 13 CA A THR 70 ? ? CB A THR 70 ? ? 1.316 1.529 -0.213 0.026 N 225 13 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.322 1.543 -0.221 0.021 N 226 13 CA A THR 90 ? ? CB A THR 90 ? ? 1.324 1.529 -0.205 0.026 N 227 13 CA A THR 95 ? ? CB A THR 95 ? ? 1.320 1.529 -0.209 0.026 N 228 13 CA A THR 101 ? ? CB A THR 101 ? ? 1.333 1.529 -0.196 0.026 N 229 13 CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 230 13 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.325 1.543 -0.218 0.021 N 231 13 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.333 1.543 -0.210 0.021 N 232 13 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.333 1.543 -0.210 0.021 N 233 13 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.329 1.543 -0.214 0.021 N 234 13 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.342 1.543 -0.201 0.021 N 235 14 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.331 1.544 -0.213 0.023 N 236 14 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.334 1.544 -0.210 0.023 N 237 14 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.329 1.544 -0.215 0.023 N 238 14 CA A THR 50 ? ? CB A THR 50 ? ? 1.333 1.529 -0.196 0.026 N 239 14 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.333 1.543 -0.210 0.021 N 240 14 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.333 1.544 -0.211 0.023 N 241 14 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.328 1.543 -0.215 0.021 N 242 14 CA A THR 70 ? ? CB A THR 70 ? ? 1.332 1.529 -0.197 0.026 N 243 14 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.323 1.543 -0.220 0.021 N 244 14 CA A THR 90 ? ? CB A THR 90 ? ? 1.330 1.529 -0.199 0.026 N 245 14 CA A THR 95 ? ? CB A THR 95 ? ? 1.317 1.529 -0.212 0.026 N 246 14 CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 247 14 CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 248 14 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.321 1.543 -0.222 0.021 N 249 14 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.328 1.543 -0.215 0.021 N 250 14 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.330 1.543 -0.213 0.021 N 251 14 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.334 1.543 -0.209 0.021 N 252 14 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.329 1.543 -0.214 0.021 N 253 15 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.329 1.544 -0.215 0.023 N 254 15 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.325 1.544 -0.219 0.023 N 255 15 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.339 1.544 -0.205 0.023 N 256 15 CA A THR 50 ? ? CB A THR 50 ? ? 1.323 1.529 -0.206 0.026 N 257 15 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.333 1.543 -0.210 0.021 N 258 15 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.339 1.544 -0.205 0.023 N 259 15 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.343 1.543 -0.200 0.021 N 260 15 CA A THR 70 ? ? CB A THR 70 ? ? 1.333 1.529 -0.196 0.026 N 261 15 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.323 1.543 -0.220 0.021 N 262 15 CA A THR 90 ? ? CB A THR 90 ? ? 1.335 1.529 -0.194 0.026 N 263 15 CA A THR 95 ? ? CB A THR 95 ? ? 1.325 1.529 -0.204 0.026 N 264 15 CA A THR 101 ? ? CB A THR 101 ? ? 1.322 1.529 -0.207 0.026 N 265 15 CA A THR 103 ? ? CB A THR 103 ? ? 1.324 1.529 -0.205 0.026 N 266 15 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 267 15 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.326 1.543 -0.217 0.021 N 268 15 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 269 15 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.328 1.543 -0.215 0.021 N 270 15 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.326 1.543 -0.217 0.021 N 271 16 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.330 1.544 -0.214 0.023 N 272 16 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.337 1.544 -0.207 0.023 N 273 16 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.323 1.544 -0.221 0.023 N 274 16 CA A THR 50 ? ? CB A THR 50 ? ? 1.333 1.529 -0.196 0.026 N 275 16 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.336 1.543 -0.207 0.021 N 276 16 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.339 1.544 -0.205 0.023 N 277 16 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.329 1.543 -0.214 0.021 N 278 16 CA A THR 70 ? ? CB A THR 70 ? ? 1.319 1.529 -0.210 0.026 N 279 16 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.324 1.543 -0.219 0.021 N 280 16 CA A THR 90 ? ? CB A THR 90 ? ? 1.336 1.529 -0.193 0.026 N 281 16 CA A THR 95 ? ? CB A THR 95 ? ? 1.324 1.529 -0.205 0.026 N 282 16 CA A THR 101 ? ? CB A THR 101 ? ? 1.322 1.529 -0.207 0.026 N 283 16 CA A THR 103 ? ? CB A THR 103 ? ? 1.325 1.529 -0.204 0.026 N 284 16 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.321 1.543 -0.222 0.021 N 285 16 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.329 1.543 -0.214 0.021 N 286 16 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.335 1.543 -0.208 0.021 N 287 16 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.339 1.543 -0.204 0.021 N 288 16 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.328 1.543 -0.215 0.021 N 289 17 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.340 1.544 -0.204 0.023 N 290 17 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.329 1.544 -0.215 0.023 N 291 17 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.327 1.544 -0.217 0.023 N 292 17 CA A THR 50 ? ? CB A THR 50 ? ? 1.316 1.529 -0.213 0.026 N 293 17 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.328 1.543 -0.215 0.021 N 294 17 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.338 1.544 -0.206 0.023 N 295 17 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.336 1.543 -0.207 0.021 N 296 17 CA A THR 70 ? ? CB A THR 70 ? ? 1.322 1.529 -0.207 0.026 N 297 17 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.326 1.543 -0.217 0.021 N 298 17 CA A THR 90 ? ? CB A THR 90 ? ? 1.336 1.529 -0.193 0.026 N 299 17 CA A THR 95 ? ? CB A THR 95 ? ? 1.329 1.529 -0.200 0.026 N 300 17 CA A THR 101 ? ? CB A THR 101 ? ? 1.320 1.529 -0.209 0.026 N 301 17 CA A THR 103 ? ? CB A THR 103 ? ? 1.315 1.529 -0.214 0.026 N 302 17 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.330 1.543 -0.213 0.021 N 303 17 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 304 17 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.326 1.543 -0.217 0.021 N 305 17 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.326 1.543 -0.217 0.021 N 306 17 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.327 1.543 -0.216 0.021 N 307 18 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.329 1.544 -0.215 0.023 N 308 18 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.332 1.544 -0.212 0.023 N 309 18 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.335 1.544 -0.209 0.023 N 310 18 CA A THR 50 ? ? CB A THR 50 ? ? 1.326 1.529 -0.203 0.026 N 311 18 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.333 1.543 -0.210 0.021 N 312 18 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.329 1.544 -0.215 0.023 N 313 18 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.328 1.543 -0.215 0.021 N 314 18 CA A THR 70 ? ? CB A THR 70 ? ? 1.323 1.529 -0.206 0.026 N 315 18 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.327 1.543 -0.216 0.021 N 316 18 CA A THR 90 ? ? CB A THR 90 ? ? 1.333 1.529 -0.196 0.026 N 317 18 CA A THR 95 ? ? CB A THR 95 ? ? 1.319 1.529 -0.210 0.026 N 318 18 CA A THR 101 ? ? CB A THR 101 ? ? 1.338 1.529 -0.191 0.026 N 319 18 CA A THR 103 ? ? CB A THR 103 ? ? 1.320 1.529 -0.209 0.026 N 320 18 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 321 18 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.327 1.543 -0.216 0.021 N 322 18 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.332 1.543 -0.211 0.021 N 323 18 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.336 1.543 -0.207 0.021 N 324 18 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.333 1.543 -0.210 0.021 N 325 19 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.340 1.544 -0.204 0.023 N 326 19 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.334 1.544 -0.210 0.023 N 327 19 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.336 1.544 -0.208 0.023 N 328 19 CA A THR 50 ? ? CB A THR 50 ? ? 1.319 1.529 -0.210 0.026 N 329 19 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.343 1.543 -0.200 0.021 N 330 19 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.330 1.544 -0.214 0.023 N 331 19 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.341 1.543 -0.202 0.021 N 332 19 CA A THR 70 ? ? CB A THR 70 ? ? 1.326 1.529 -0.203 0.026 N 333 19 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.324 1.543 -0.219 0.021 N 334 19 CA A THR 90 ? ? CB A THR 90 ? ? 1.339 1.529 -0.190 0.026 N 335 19 CA A THR 95 ? ? CB A THR 95 ? ? 1.319 1.529 -0.210 0.026 N 336 19 CA A THR 101 ? ? CB A THR 101 ? ? 1.317 1.529 -0.212 0.026 N 337 19 CA A THR 103 ? ? CB A THR 103 ? ? 1.318 1.529 -0.211 0.026 N 338 19 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.324 1.543 -0.219 0.021 N 339 19 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.331 1.543 -0.212 0.021 N 340 19 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.330 1.543 -0.213 0.021 N 341 19 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.335 1.543 -0.208 0.021 N 342 19 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.332 1.543 -0.211 0.021 N 343 20 CA A ILE 31 ? ? CB A ILE 31 ? ? 1.328 1.544 -0.216 0.023 N 344 20 CA A ILE 39 ? ? CB A ILE 39 ? ? 1.320 1.544 -0.224 0.023 N 345 20 CA A ILE 49 ? ? CB A ILE 49 ? ? 1.330 1.544 -0.214 0.023 N 346 20 CA A THR 50 ? ? CB A THR 50 ? ? 1.332 1.529 -0.197 0.026 N 347 20 CA A VAL 57 ? ? CB A VAL 57 ? ? 1.337 1.543 -0.206 0.021 N 348 20 CA A ILE 58 ? ? CB A ILE 58 ? ? 1.339 1.544 -0.205 0.023 N 349 20 CA A VAL 66 ? ? CB A VAL 66 ? ? 1.343 1.543 -0.200 0.021 N 350 20 CA A THR 70 ? ? CB A THR 70 ? ? 1.329 1.529 -0.200 0.026 N 351 20 CA A VAL 83 ? ? CB A VAL 83 ? ? 1.322 1.543 -0.221 0.021 N 352 20 CA A THR 90 ? ? CB A THR 90 ? ? 1.334 1.529 -0.195 0.026 N 353 20 CA A THR 95 ? ? CB A THR 95 ? ? 1.318 1.529 -0.211 0.026 N 354 20 CA A THR 101 ? ? CB A THR 101 ? ? 1.321 1.529 -0.208 0.026 N 355 20 CA A THR 103 ? ? CB A THR 103 ? ? 1.320 1.529 -0.209 0.026 N 356 20 CA A VAL 105 ? ? CB A VAL 105 ? ? 1.326 1.543 -0.217 0.021 N 357 20 CA A VAL 107 ? ? CB A VAL 107 ? ? 1.329 1.543 -0.214 0.021 N 358 20 CA A VAL 120 ? ? CB A VAL 120 ? ? 1.331 1.543 -0.212 0.021 N 359 20 CA A VAL 122 ? ? CB A VAL 122 ? ? 1.337 1.543 -0.206 0.021 N 360 20 CA A VAL 125 ? ? CB A VAL 125 ? ? 1.338 1.543 -0.205 0.021 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 44 ? ? 176.18 -32.53 2 1 GLU A 46 ? ? -147.45 40.46 3 1 LYS A 55 ? ? -99.05 32.20 4 1 ILE A 58 ? ? 50.73 166.66 5 1 TYR A 76 ? ? 50.40 -113.60 6 1 ASN A 87 ? ? -157.18 48.65 7 1 TYR A 98 ? ? -100.31 -166.51 8 1 MET A 100 ? ? -95.74 33.40 9 2 ALA A 44 ? ? -170.20 13.04 10 2 PRO A 54 ? ? -83.40 36.94 11 2 ILE A 58 ? ? 37.85 73.53 12 2 PHE A 62 ? ? 34.82 79.09 13 2 VAL A 66 ? ? 54.79 78.72 14 2 ALA A 67 ? ? -39.56 105.95 15 2 GLU A 74 ? ? -80.10 43.65 16 2 TYR A 76 ? ? 52.22 -96.98 17 2 ASN A 87 ? ? -164.00 54.63 18 2 LEU A 88 ? ? -65.37 96.11 19 2 ASP A 97 ? ? 63.94 -168.14 20 2 TYR A 98 ? ? -155.74 2.84 21 2 LEU A 113 ? ? -67.07 1.27 22 2 SER A 117 ? ? 179.25 151.32 23 3 GLU A 46 ? ? 67.57 103.18 24 3 ILE A 49 ? ? 33.97 47.75 25 3 GLN A 56 ? ? -107.16 44.32 26 3 LYS A 60 ? ? -69.25 90.45 27 3 ALA A 67 ? ? -38.22 110.27 28 3 CYS A 69 ? ? 61.94 179.43 29 3 TYR A 76 ? ? 54.15 -106.30 30 3 ASN A 87 ? ? -162.85 55.75 31 3 LEU A 88 ? ? -69.07 83.61 32 3 ASP A 97 ? ? -84.44 -123.18 33 3 MET A 100 ? ? 48.25 21.72 34 3 PRO A 102 ? ? -80.07 -73.84 35 4 GLN A 56 ? ? -161.81 -46.94 36 4 ASP A 65 ? ? -172.07 120.21 37 4 VAL A 66 ? ? -150.35 37.33 38 4 ALA A 67 ? ? 61.86 106.45 39 4 SER A 72 ? ? 57.02 79.29 40 4 GLU A 74 ? ? -167.63 -49.92 41 4 ASN A 87 ? ? -158.89 50.19 42 4 TYR A 98 ? ? 177.50 -149.37 43 4 PRO A 102 ? ? -56.41 86.82 44 5 ALA A 27 ? ? 69.35 145.39 45 5 GLU A 46 ? ? 68.14 -178.82 46 5 THR A 50 ? ? -95.00 49.22 47 5 ILE A 58 ? ? 38.70 73.44 48 5 LYS A 64 ? ? -170.15 141.64 49 5 ASN A 87 ? ? -169.96 62.61 50 5 LEU A 88 ? ? -38.45 102.35 51 5 ASP A 97 ? ? -69.46 -79.52 52 5 MET A 100 ? ? 177.84 -53.19 53 6 THR A 50 ? ? 57.29 75.44 54 6 ILE A 58 ? ? 69.49 148.34 55 6 VAL A 66 ? ? -122.84 -51.27 56 6 ALA A 67 ? ? 169.15 136.64 57 6 PRO A 68 ? ? -69.08 92.87 58 6 CYS A 69 ? ? -154.92 27.94 59 6 ASP A 71 ? ? -58.48 -94.09 60 6 SER A 72 ? ? 172.37 135.87 61 6 ASN A 87 ? ? -156.04 52.59 62 6 PRO A 102 ? ? -69.39 86.12 63 6 LYS A 111 ? ? -57.72 106.79 64 7 ALA A 27 ? ? 68.86 143.81 65 7 PHE A 28 ? ? -170.24 -68.62 66 7 LYS A 55 ? ? 32.32 77.82 67 7 GLN A 56 ? ? -157.09 -71.10 68 7 PHE A 62 ? ? -160.18 109.46 69 7 ALA A 67 ? ? -152.64 -50.36 70 7 ASP A 71 ? ? 61.04 -92.12 71 7 TYR A 76 ? ? 69.79 -80.54 72 7 ASN A 87 ? ? -166.02 62.14 73 7 LEU A 88 ? ? -68.86 98.24 74 7 PHE A 96 ? ? -69.29 92.66 75 7 GLN A 99 ? ? 61.19 -145.08 76 7 SER A 117 ? ? 179.98 156.50 77 8 LEU A 40 ? ? -102.17 -65.24 78 8 GLU A 46 ? ? -63.59 88.72 79 8 ILE A 58 ? ? 38.13 64.28 80 8 PHE A 63 ? ? -121.50 -58.20 81 8 ALA A 67 ? ? 69.48 95.84 82 8 ASN A 87 ? ? -153.78 52.30 83 8 LEU A 88 ? ? -67.24 86.45 84 8 GLN A 99 ? ? -95.13 -66.58 85 9 ALA A 27 ? ? 68.95 -76.79 86 9 ASP A 36 ? ? -135.44 -33.51 87 9 ALA A 44 ? ? -174.63 98.94 88 9 LYS A 64 ? ? -173.10 120.94 89 9 THR A 70 ? ? -135.23 -62.47 90 9 ASN A 87 ? ? -148.56 49.30 91 9 GLN A 99 ? ? 68.81 -59.84 92 9 PRO A 102 ? ? -91.55 45.03 93 9 ASP A 116 ? ? -87.45 41.42 94 10 GLU A 46 ? ? -68.54 99.40 95 10 PRO A 54 ? ? -75.18 39.29 96 10 VAL A 57 ? ? -86.14 36.16 97 10 PHE A 63 ? ? -81.79 37.02 98 10 ASP A 65 ? ? 62.00 71.67 99 10 CYS A 69 ? ? -151.00 -159.90 100 10 ASP A 71 ? ? 66.59 107.24 101 10 LYS A 78 ? ? 53.65 70.22 102 10 ASN A 87 ? ? -175.23 69.98 103 10 LEU A 88 ? ? -58.75 88.09 104 10 TYR A 98 ? ? 65.13 -89.02 105 10 GLN A 99 ? ? -161.76 -55.37 106 10 MET A 100 ? ? -105.57 -70.80 107 10 ASP A 116 ? ? -86.58 34.09 108 11 VAL A 57 ? ? -111.48 74.65 109 11 PHE A 62 ? ? -151.01 5.29 110 11 PHE A 63 ? ? 63.31 -95.20 111 11 ASN A 87 ? ? -148.42 50.28 112 11 PRO A 102 ? ? -58.65 88.62 113 12 ILE A 49 ? ? -92.67 44.04 114 12 LYS A 55 ? ? 64.06 94.31 115 12 VAL A 57 ? ? 62.61 -70.15 116 12 PHE A 62 ? ? -61.59 99.31 117 12 VAL A 66 ? ? 37.77 43.13 118 12 ASP A 71 ? ? -167.76 -69.99 119 12 PRO A 73 ? ? -73.92 40.51 120 12 GLU A 74 ? ? 65.72 -179.20 121 12 ASN A 87 ? ? -163.40 55.57 122 12 LEU A 88 ? ? -68.65 88.95 123 12 ASP A 97 ? ? -88.10 -151.61 124 13 GLN A 56 ? ? -127.10 -87.01 125 13 VAL A 57 ? ? -136.46 -44.56 126 13 ASP A 65 ? ? 74.84 -54.24 127 13 ASN A 87 ? ? -140.31 42.46 128 13 LEU A 88 ? ? -69.21 89.13 129 13 ASP A 97 ? ? 69.33 171.71 130 13 TYR A 98 ? ? 67.46 -171.80 131 13 GLN A 99 ? ? 71.17 -178.16 132 13 THR A 103 ? ? -56.57 98.29 133 14 ASP A 36 ? ? -140.47 -33.67 134 14 LEU A 40 ? ? -106.08 -62.69 135 14 PRO A 54 ? ? -36.75 97.31 136 14 LYS A 64 ? ? -149.95 29.86 137 14 THR A 70 ? ? 66.76 158.01 138 14 PRO A 73 ? ? -81.30 37.92 139 14 TYR A 76 ? ? 50.43 122.87 140 14 ASN A 87 ? ? -162.28 59.13 141 14 LEU A 88 ? ? -60.60 93.01 142 14 GLN A 99 ? ? -112.32 -148.80 143 14 THR A 103 ? ? -67.18 97.35 144 15 PHE A 28 ? ? -124.26 -57.60 145 15 GLU A 46 ? ? 64.35 70.71 146 15 LYS A 64 ? ? 177.58 82.12 147 15 ASP A 65 ? ? -98.88 -69.24 148 15 VAL A 66 ? ? 35.84 64.33 149 15 PRO A 73 ? ? -81.34 41.47 150 15 PHE A 75 ? ? -158.61 42.45 151 15 TYR A 76 ? ? -119.33 -97.83 152 15 LYS A 78 ? ? 63.26 86.06 153 15 ASN A 87 ? ? -165.54 48.66 154 15 LEU A 88 ? ? -58.28 93.81 155 15 TYR A 98 ? ? -155.32 -60.39 156 15 GLN A 99 ? ? -158.13 -78.00 157 15 MET A 100 ? ? -118.58 -87.76 158 16 THR A 50 ? ? 67.22 150.42 159 16 ILE A 58 ? ? 37.31 65.58 160 16 PHE A 62 ? ? 174.26 132.94 161 16 PRO A 68 ? ? -65.86 80.76 162 16 SER A 72 ? ? -168.65 -45.90 163 16 PHE A 75 ? ? 73.90 -28.17 164 16 TYR A 76 ? ? 47.76 -97.89 165 16 ASN A 87 ? ? -171.42 66.61 166 16 LEU A 88 ? ? -56.44 88.11 167 16 TYR A 98 ? ? -130.19 -82.61 168 16 GLN A 99 ? ? 67.18 -67.32 169 16 MET A 100 ? ? -171.24 -59.51 170 16 PRO A 102 ? ? -45.29 101.09 171 16 LYS A 111 ? ? -56.82 108.38 172 16 ASP A 116 ? ? 26.96 72.48 173 17 PHE A 28 ? ? 71.71 152.21 174 17 THR A 50 ? ? -60.34 95.13 175 17 VAL A 57 ? ? -100.56 47.69 176 17 VAL A 66 ? ? -148.90 37.96 177 17 CYS A 69 ? ? -151.92 78.94 178 17 THR A 70 ? ? -123.57 -50.12 179 17 PRO A 73 ? ? -41.24 103.95 180 17 TYR A 76 ? ? -68.49 -72.47 181 17 ASN A 87 ? ? -158.37 44.80 182 17 LEU A 88 ? ? -66.06 86.40 183 17 GLN A 99 ? ? -179.36 86.27 184 17 MET A 100 ? ? 77.70 -14.71 185 18 ASP A 36 ? ? 174.75 -57.17 186 18 PHE A 62 ? ? -164.95 88.34 187 18 PHE A 63 ? ? -72.52 -73.53 188 18 LYS A 64 ? ? -150.70 71.91 189 18 THR A 70 ? ? 71.07 -54.40 190 18 SER A 72 ? ? -159.79 -43.25 191 18 TYR A 76 ? ? -114.97 -76.15 192 18 ASN A 87 ? ? -162.37 52.74 193 18 TYR A 98 ? ? 73.27 -14.46 194 19 ALA A 44 ? ? 72.30 166.66 195 19 LYS A 55 ? ? 59.67 71.19 196 19 VAL A 57 ? ? -69.24 87.54 197 19 ILE A 58 ? ? 60.40 73.65 198 19 PHE A 62 ? ? 48.57 83.02 199 19 LYS A 64 ? ? -149.94 -73.94 200 19 ASP A 65 ? ? 68.26 -14.68 201 19 GLU A 74 ? ? 66.83 -77.30 202 19 ASN A 87 ? ? -162.34 57.27 203 19 LEU A 88 ? ? -65.08 81.41 204 19 TYR A 98 ? ? -155.82 -69.02 205 19 GLN A 99 ? ? -159.82 32.24 206 19 PRO A 102 ? ? -62.38 94.78 207 19 ASP A 116 ? ? -88.68 49.02 208 20 ILE A 49 ? ? -102.76 53.67 209 20 THR A 50 ? ? 69.83 159.98 210 20 LYS A 55 ? ? -84.00 38.24 211 20 VAL A 57 ? ? -96.67 51.63 212 20 VAL A 66 ? ? -153.94 -60.70 213 20 ALA A 67 ? ? 39.91 70.14 214 20 PRO A 73 ? ? -67.70 -73.99 215 20 PHE A 75 ? ? 68.16 97.40 216 20 ASN A 87 ? ? -162.55 59.21 217 20 LEU A 88 ? ? -64.76 84.79 218 20 TYR A 98 ? ? 73.37 -40.40 219 20 PRO A 102 ? ? -78.05 42.21 220 20 THR A 103 ? ? -64.89 98.87 221 20 SER A 117 ? ? 60.40 155.67 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 13 ? A HIS 1 2 1 Y 1 A HIS 14 ? A HIS 2 3 1 Y 1 A HIS 15 ? A HIS 3 4 1 Y 1 A HIS 16 ? A HIS 4 5 1 Y 1 A HIS 17 ? A HIS 5 6 1 Y 1 A HIS 18 ? A HIS 6 7 1 Y 1 A GLU 19 ? A GLU 7 8 1 Y 1 A SER 20 ? A SER 8 9 1 Y 1 A ASP 21 ? A ASP 9 10 1 Y 1 A ASP 22 ? A ASP 10 11 1 Y 1 A ASP 23 ? A ASP 11 12 1 Y 1 A ASP 24 ? A ASP 12 13 1 Y 1 A LYS 25 ? A LYS 13 14 2 Y 1 A HIS 13 ? A HIS 1 15 2 Y 1 A HIS 14 ? A HIS 2 16 2 Y 1 A HIS 15 ? A HIS 3 17 2 Y 1 A HIS 16 ? A HIS 4 18 2 Y 1 A HIS 17 ? A HIS 5 19 2 Y 1 A HIS 18 ? A HIS 6 20 2 Y 1 A GLU 19 ? A GLU 7 21 2 Y 1 A SER 20 ? A SER 8 22 2 Y 1 A ASP 21 ? A ASP 9 23 2 Y 1 A ASP 22 ? A ASP 10 24 2 Y 1 A ASP 23 ? A ASP 11 25 2 Y 1 A ASP 24 ? A ASP 12 26 2 Y 1 A LYS 25 ? A LYS 13 27 3 Y 1 A HIS 13 ? A HIS 1 28 3 Y 1 A HIS 14 ? A HIS 2 29 3 Y 1 A HIS 15 ? A HIS 3 30 3 Y 1 A HIS 16 ? A HIS 4 31 3 Y 1 A HIS 17 ? A HIS 5 32 3 Y 1 A HIS 18 ? A HIS 6 33 3 Y 1 A GLU 19 ? A GLU 7 34 3 Y 1 A SER 20 ? A SER 8 35 3 Y 1 A ASP 21 ? A ASP 9 36 3 Y 1 A ASP 22 ? A ASP 10 37 3 Y 1 A ASP 23 ? A ASP 11 38 3 Y 1 A ASP 24 ? A ASP 12 39 3 Y 1 A LYS 25 ? A LYS 13 40 4 Y 1 A HIS 13 ? A HIS 1 41 4 Y 1 A HIS 14 ? A HIS 2 42 4 Y 1 A HIS 15 ? A HIS 3 43 4 Y 1 A HIS 16 ? A HIS 4 44 4 Y 1 A HIS 17 ? A HIS 5 45 4 Y 1 A HIS 18 ? A HIS 6 46 4 Y 1 A GLU 19 ? A GLU 7 47 4 Y 1 A SER 20 ? A SER 8 48 4 Y 1 A ASP 21 ? A ASP 9 49 4 Y 1 A ASP 22 ? A ASP 10 50 4 Y 1 A ASP 23 ? A ASP 11 51 4 Y 1 A ASP 24 ? A ASP 12 52 4 Y 1 A LYS 25 ? A LYS 13 53 5 Y 1 A HIS 13 ? A HIS 1 54 5 Y 1 A HIS 14 ? A HIS 2 55 5 Y 1 A HIS 15 ? A HIS 3 56 5 Y 1 A HIS 16 ? A HIS 4 57 5 Y 1 A HIS 17 ? A HIS 5 58 5 Y 1 A HIS 18 ? A HIS 6 59 5 Y 1 A GLU 19 ? A GLU 7 60 5 Y 1 A SER 20 ? A SER 8 61 5 Y 1 A ASP 21 ? A ASP 9 62 5 Y 1 A ASP 22 ? A ASP 10 63 5 Y 1 A ASP 23 ? A ASP 11 64 5 Y 1 A ASP 24 ? A ASP 12 65 5 Y 1 A LYS 25 ? A LYS 13 66 6 Y 1 A HIS 13 ? A HIS 1 67 6 Y 1 A HIS 14 ? A HIS 2 68 6 Y 1 A HIS 15 ? A HIS 3 69 6 Y 1 A HIS 16 ? A HIS 4 70 6 Y 1 A HIS 17 ? A HIS 5 71 6 Y 1 A HIS 18 ? A HIS 6 72 6 Y 1 A GLU 19 ? A GLU 7 73 6 Y 1 A SER 20 ? A SER 8 74 6 Y 1 A ASP 21 ? A ASP 9 75 6 Y 1 A ASP 22 ? A ASP 10 76 6 Y 1 A ASP 23 ? A ASP 11 77 6 Y 1 A ASP 24 ? A ASP 12 78 6 Y 1 A LYS 25 ? A LYS 13 79 7 Y 1 A HIS 13 ? A HIS 1 80 7 Y 1 A HIS 14 ? A HIS 2 81 7 Y 1 A HIS 15 ? A HIS 3 82 7 Y 1 A HIS 16 ? A HIS 4 83 7 Y 1 A HIS 17 ? A HIS 5 84 7 Y 1 A HIS 18 ? A HIS 6 85 7 Y 1 A GLU 19 ? A GLU 7 86 7 Y 1 A SER 20 ? A SER 8 87 7 Y 1 A ASP 21 ? A ASP 9 88 7 Y 1 A ASP 22 ? A ASP 10 89 7 Y 1 A ASP 23 ? A ASP 11 90 7 Y 1 A ASP 24 ? A ASP 12 91 7 Y 1 A LYS 25 ? A LYS 13 92 8 Y 1 A HIS 13 ? A HIS 1 93 8 Y 1 A HIS 14 ? A HIS 2 94 8 Y 1 A HIS 15 ? A HIS 3 95 8 Y 1 A HIS 16 ? A HIS 4 96 8 Y 1 A HIS 17 ? A HIS 5 97 8 Y 1 A HIS 18 ? A HIS 6 98 8 Y 1 A GLU 19 ? A GLU 7 99 8 Y 1 A SER 20 ? A SER 8 100 8 Y 1 A ASP 21 ? A ASP 9 101 8 Y 1 A ASP 22 ? A ASP 10 102 8 Y 1 A ASP 23 ? A ASP 11 103 8 Y 1 A ASP 24 ? A ASP 12 104 8 Y 1 A LYS 25 ? A LYS 13 105 9 Y 1 A HIS 13 ? A HIS 1 106 9 Y 1 A HIS 14 ? A HIS 2 107 9 Y 1 A HIS 15 ? A HIS 3 108 9 Y 1 A HIS 16 ? A HIS 4 109 9 Y 1 A HIS 17 ? A HIS 5 110 9 Y 1 A HIS 18 ? A HIS 6 111 9 Y 1 A GLU 19 ? A GLU 7 112 9 Y 1 A SER 20 ? A SER 8 113 9 Y 1 A ASP 21 ? A ASP 9 114 9 Y 1 A ASP 22 ? A ASP 10 115 9 Y 1 A ASP 23 ? A ASP 11 116 9 Y 1 A ASP 24 ? A ASP 12 117 9 Y 1 A LYS 25 ? A LYS 13 118 10 Y 1 A HIS 13 ? A HIS 1 119 10 Y 1 A HIS 14 ? A HIS 2 120 10 Y 1 A HIS 15 ? A HIS 3 121 10 Y 1 A HIS 16 ? A HIS 4 122 10 Y 1 A HIS 17 ? A HIS 5 123 10 Y 1 A HIS 18 ? A HIS 6 124 10 Y 1 A GLU 19 ? A GLU 7 125 10 Y 1 A SER 20 ? A SER 8 126 10 Y 1 A ASP 21 ? A ASP 9 127 10 Y 1 A ASP 22 ? A ASP 10 128 10 Y 1 A ASP 23 ? A ASP 11 129 10 Y 1 A ASP 24 ? A ASP 12 130 10 Y 1 A LYS 25 ? A LYS 13 131 11 Y 1 A HIS 13 ? A HIS 1 132 11 Y 1 A HIS 14 ? A HIS 2 133 11 Y 1 A HIS 15 ? A HIS 3 134 11 Y 1 A HIS 16 ? A HIS 4 135 11 Y 1 A HIS 17 ? A HIS 5 136 11 Y 1 A HIS 18 ? A HIS 6 137 11 Y 1 A GLU 19 ? A GLU 7 138 11 Y 1 A SER 20 ? A SER 8 139 11 Y 1 A ASP 21 ? A ASP 9 140 11 Y 1 A ASP 22 ? A ASP 10 141 11 Y 1 A ASP 23 ? A ASP 11 142 11 Y 1 A ASP 24 ? A ASP 12 143 11 Y 1 A LYS 25 ? A LYS 13 144 12 Y 1 A HIS 13 ? A HIS 1 145 12 Y 1 A HIS 14 ? A HIS 2 146 12 Y 1 A HIS 15 ? A HIS 3 147 12 Y 1 A HIS 16 ? A HIS 4 148 12 Y 1 A HIS 17 ? A HIS 5 149 12 Y 1 A HIS 18 ? A HIS 6 150 12 Y 1 A GLU 19 ? A GLU 7 151 12 Y 1 A SER 20 ? A SER 8 152 12 Y 1 A ASP 21 ? A ASP 9 153 12 Y 1 A ASP 22 ? A ASP 10 154 12 Y 1 A ASP 23 ? A ASP 11 155 12 Y 1 A ASP 24 ? A ASP 12 156 12 Y 1 A LYS 25 ? A LYS 13 157 13 Y 1 A HIS 13 ? A HIS 1 158 13 Y 1 A HIS 14 ? A HIS 2 159 13 Y 1 A HIS 15 ? A HIS 3 160 13 Y 1 A HIS 16 ? A HIS 4 161 13 Y 1 A HIS 17 ? A HIS 5 162 13 Y 1 A HIS 18 ? A HIS 6 163 13 Y 1 A GLU 19 ? A GLU 7 164 13 Y 1 A SER 20 ? A SER 8 165 13 Y 1 A ASP 21 ? A ASP 9 166 13 Y 1 A ASP 22 ? A ASP 10 167 13 Y 1 A ASP 23 ? A ASP 11 168 13 Y 1 A ASP 24 ? A ASP 12 169 13 Y 1 A LYS 25 ? A LYS 13 170 14 Y 1 A HIS 13 ? A HIS 1 171 14 Y 1 A HIS 14 ? A HIS 2 172 14 Y 1 A HIS 15 ? A HIS 3 173 14 Y 1 A HIS 16 ? A HIS 4 174 14 Y 1 A HIS 17 ? A HIS 5 175 14 Y 1 A HIS 18 ? A HIS 6 176 14 Y 1 A GLU 19 ? A GLU 7 177 14 Y 1 A SER 20 ? A SER 8 178 14 Y 1 A ASP 21 ? A ASP 9 179 14 Y 1 A ASP 22 ? A ASP 10 180 14 Y 1 A ASP 23 ? A ASP 11 181 14 Y 1 A ASP 24 ? A ASP 12 182 14 Y 1 A LYS 25 ? A LYS 13 183 15 Y 1 A HIS 13 ? A HIS 1 184 15 Y 1 A HIS 14 ? A HIS 2 185 15 Y 1 A HIS 15 ? A HIS 3 186 15 Y 1 A HIS 16 ? A HIS 4 187 15 Y 1 A HIS 17 ? A HIS 5 188 15 Y 1 A HIS 18 ? A HIS 6 189 15 Y 1 A GLU 19 ? A GLU 7 190 15 Y 1 A SER 20 ? A SER 8 191 15 Y 1 A ASP 21 ? A ASP 9 192 15 Y 1 A ASP 22 ? A ASP 10 193 15 Y 1 A ASP 23 ? A ASP 11 194 15 Y 1 A ASP 24 ? A ASP 12 195 15 Y 1 A LYS 25 ? A LYS 13 196 16 Y 1 A HIS 13 ? A HIS 1 197 16 Y 1 A HIS 14 ? A HIS 2 198 16 Y 1 A HIS 15 ? A HIS 3 199 16 Y 1 A HIS 16 ? A HIS 4 200 16 Y 1 A HIS 17 ? A HIS 5 201 16 Y 1 A HIS 18 ? A HIS 6 202 16 Y 1 A GLU 19 ? A GLU 7 203 16 Y 1 A SER 20 ? A SER 8 204 16 Y 1 A ASP 21 ? A ASP 9 205 16 Y 1 A ASP 22 ? A ASP 10 206 16 Y 1 A ASP 23 ? A ASP 11 207 16 Y 1 A ASP 24 ? A ASP 12 208 16 Y 1 A LYS 25 ? A LYS 13 209 17 Y 1 A HIS 13 ? A HIS 1 210 17 Y 1 A HIS 14 ? A HIS 2 211 17 Y 1 A HIS 15 ? A HIS 3 212 17 Y 1 A HIS 16 ? A HIS 4 213 17 Y 1 A HIS 17 ? A HIS 5 214 17 Y 1 A HIS 18 ? A HIS 6 215 17 Y 1 A GLU 19 ? A GLU 7 216 17 Y 1 A SER 20 ? A SER 8 217 17 Y 1 A ASP 21 ? A ASP 9 218 17 Y 1 A ASP 22 ? A ASP 10 219 17 Y 1 A ASP 23 ? A ASP 11 220 17 Y 1 A ASP 24 ? A ASP 12 221 17 Y 1 A LYS 25 ? A LYS 13 222 18 Y 1 A HIS 13 ? A HIS 1 223 18 Y 1 A HIS 14 ? A HIS 2 224 18 Y 1 A HIS 15 ? A HIS 3 225 18 Y 1 A HIS 16 ? A HIS 4 226 18 Y 1 A HIS 17 ? A HIS 5 227 18 Y 1 A HIS 18 ? A HIS 6 228 18 Y 1 A GLU 19 ? A GLU 7 229 18 Y 1 A SER 20 ? A SER 8 230 18 Y 1 A ASP 21 ? A ASP 9 231 18 Y 1 A ASP 22 ? A ASP 10 232 18 Y 1 A ASP 23 ? A ASP 11 233 18 Y 1 A ASP 24 ? A ASP 12 234 18 Y 1 A LYS 25 ? A LYS 13 235 19 Y 1 A HIS 13 ? A HIS 1 236 19 Y 1 A HIS 14 ? A HIS 2 237 19 Y 1 A HIS 15 ? A HIS 3 238 19 Y 1 A HIS 16 ? A HIS 4 239 19 Y 1 A HIS 17 ? A HIS 5 240 19 Y 1 A HIS 18 ? A HIS 6 241 19 Y 1 A GLU 19 ? A GLU 7 242 19 Y 1 A SER 20 ? A SER 8 243 19 Y 1 A ASP 21 ? A ASP 9 244 19 Y 1 A ASP 22 ? A ASP 10 245 19 Y 1 A ASP 23 ? A ASP 11 246 19 Y 1 A ASP 24 ? A ASP 12 247 19 Y 1 A LYS 25 ? A LYS 13 248 20 Y 1 A HIS 13 ? A HIS 1 249 20 Y 1 A HIS 14 ? A HIS 2 250 20 Y 1 A HIS 15 ? A HIS 3 251 20 Y 1 A HIS 16 ? A HIS 4 252 20 Y 1 A HIS 17 ? A HIS 5 253 20 Y 1 A HIS 18 ? A HIS 6 254 20 Y 1 A GLU 19 ? A GLU 7 255 20 Y 1 A SER 20 ? A SER 8 256 20 Y 1 A ASP 21 ? A ASP 9 257 20 Y 1 A ASP 22 ? A ASP 10 258 20 Y 1 A ASP 23 ? A ASP 11 259 20 Y 1 A ASP 24 ? A ASP 12 260 20 Y 1 A LYS 25 ? A LYS 13 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;4'-HYDROXYCINNAMIC ACID ; _pdbx_entity_nonpoly.comp_id HC4 #