data_1XG9 # _entry.id 1XG9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1XG9 RCSB RCSB030330 WWPDB D_1000030330 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.pdb_id 1ZGH _pdbx_database_PDB_obs_spr.replace_pdb_id 1XG9 _pdbx_database_PDB_obs_spr.date 2005-05-03 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id Cth-2336 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 1XG9 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2004-09-16 _pdbx_database_status.status_code OBS _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yang, H.' 1 'Kataeva, I.' 2 'Xu, H.' 3 'Zhao, M.' 4 'Chang, J.' 5 'Liu, Z.-J.' 6 'Chen, L.' 7 'Tempel, W.' 8 'Habel, J.' 9 'Zhou, W.' 10 'Lee, D.' 11 'Lin, D.' 12 'Chang, S.-H.' 13 'Arendall III, W.B.' 14 'Richardson, J.S.' 15 'Richardson, D.C.' 16 'Rose, J.P.' 17 'Wang, B.-C.' 18 'Southeast Collaboratory for Structural Genomics (SECSG)' 19 # _citation.id primary _citation.title 'Methionyl-tRNA formyltransferase from Clostridium thermocellum' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yang, H.' 1 primary 'Kataeva, I.' 2 primary 'Xu, H.' 3 primary 'Zhao, M.' 4 primary 'Chang, J.' 5 primary 'Liu, Z.-J.' 6 primary 'Chen, L.' 7 primary 'Tempel, W.' 8 primary 'Habel, J.' 9 primary 'Zhou, W.' 10 primary 'Lee, D.' 11 primary 'Lin, D.' 12 primary 'Chang, S.-H.' 13 primary 'Arendall III, W.B.' 14 primary 'Richardson, J.S.' 15 primary 'Richardson, D.C.' 16 primary 'Rose, J.P.' 17 primary 'Wang, B.-C.' 18 primary 'Southeast Collaboratory for Structural Genomics' 19 # _cell.entry_id 1XG9 _cell.length_a 85.396 _cell.length_b 85.396 _cell.length_c 104.270 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XG9 _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Methionyl-tRNA formyltransferase' 30354.680 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 59 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GSSHHHHHHSSGLVPRGSQSTSLYKKAGL(MSE)NIIIATTKSWNIKNAQKFKKENESKYNTTIITNKDELTFEK VKLINPEYILFPHWSWIIPKEIFENFTCVVFH(MSE)TDLPFGRGGSPLQNLIERGIKKTKISAIKVDGGIDTGDIFFKR DLDLYGTAEEIF(MSE)RASKIIFND(MSE)IPELLTKRPVPQKQEGEATVFQRRKPEQSEISPDFDLEKIYDYIR (MSE)LDGEGYPRAFIKYGKYRLEFSRAS(MSE)KNGKIIADVEIIEGDENE ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSQSTSLYKKAGLMNIIIATTKSWNIKNAQKFKKENESKYNTTIITNKDELTFEKVKLINPEY ILFPHWSWIIPKEIFENFTCVVFHMTDLPFGRGGSPLQNLIERGIKKTKISAIKVDGGIDTGDIFFKRDLDLYGTAEEIF MRASKIIFNDMIPELLTKRPVPQKQEGEATVFQRRKPEQSEISPDFDLEKIYDYIRMLDGEGYPRAFIKYGKYRLEFSRA SMKNGKIIADVEIIEGDENE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier Cth-2336 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 GLN n 1 21 SER n 1 22 THR n 1 23 SER n 1 24 LEU n 1 25 TYR n 1 26 LYS n 1 27 LYS n 1 28 ALA n 1 29 GLY n 1 30 LEU n 1 31 MSE n 1 32 ASN n 1 33 ILE n 1 34 ILE n 1 35 ILE n 1 36 ALA n 1 37 THR n 1 38 THR n 1 39 LYS n 1 40 SER n 1 41 TRP n 1 42 ASN n 1 43 ILE n 1 44 LYS n 1 45 ASN n 1 46 ALA n 1 47 GLN n 1 48 LYS n 1 49 PHE n 1 50 LYS n 1 51 LYS n 1 52 GLU n 1 53 ASN n 1 54 GLU n 1 55 SER n 1 56 LYS n 1 57 TYR n 1 58 ASN n 1 59 THR n 1 60 THR n 1 61 ILE n 1 62 ILE n 1 63 THR n 1 64 ASN n 1 65 LYS n 1 66 ASP n 1 67 GLU n 1 68 LEU n 1 69 THR n 1 70 PHE n 1 71 GLU n 1 72 LYS n 1 73 VAL n 1 74 LYS n 1 75 LEU n 1 76 ILE n 1 77 ASN n 1 78 PRO n 1 79 GLU n 1 80 TYR n 1 81 ILE n 1 82 LEU n 1 83 PHE n 1 84 PRO n 1 85 HIS n 1 86 TRP n 1 87 SER n 1 88 TRP n 1 89 ILE n 1 90 ILE n 1 91 PRO n 1 92 LYS n 1 93 GLU n 1 94 ILE n 1 95 PHE n 1 96 GLU n 1 97 ASN n 1 98 PHE n 1 99 THR n 1 100 CYS n 1 101 VAL n 1 102 VAL n 1 103 PHE n 1 104 HIS n 1 105 MSE n 1 106 THR n 1 107 ASP n 1 108 LEU n 1 109 PRO n 1 110 PHE n 1 111 GLY n 1 112 ARG n 1 113 GLY n 1 114 GLY n 1 115 SER n 1 116 PRO n 1 117 LEU n 1 118 GLN n 1 119 ASN n 1 120 LEU n 1 121 ILE n 1 122 GLU n 1 123 ARG n 1 124 GLY n 1 125 ILE n 1 126 LYS n 1 127 LYS n 1 128 THR n 1 129 LYS n 1 130 ILE n 1 131 SER n 1 132 ALA n 1 133 ILE n 1 134 LYS n 1 135 VAL n 1 136 ASP n 1 137 GLY n 1 138 GLY n 1 139 ILE n 1 140 ASP n 1 141 THR n 1 142 GLY n 1 143 ASP n 1 144 ILE n 1 145 PHE n 1 146 PHE n 1 147 LYS n 1 148 ARG n 1 149 ASP n 1 150 LEU n 1 151 ASP n 1 152 LEU n 1 153 TYR n 1 154 GLY n 1 155 THR n 1 156 ALA n 1 157 GLU n 1 158 GLU n 1 159 ILE n 1 160 PHE n 1 161 MSE n 1 162 ARG n 1 163 ALA n 1 164 SER n 1 165 LYS n 1 166 ILE n 1 167 ILE n 1 168 PHE n 1 169 ASN n 1 170 ASP n 1 171 MSE n 1 172 ILE n 1 173 PRO n 1 174 GLU n 1 175 LEU n 1 176 LEU n 1 177 THR n 1 178 LYS n 1 179 ARG n 1 180 PRO n 1 181 VAL n 1 182 PRO n 1 183 GLN n 1 184 LYS n 1 185 GLN n 1 186 GLU n 1 187 GLY n 1 188 GLU n 1 189 ALA n 1 190 THR n 1 191 VAL n 1 192 PHE n 1 193 GLN n 1 194 ARG n 1 195 ARG n 1 196 LYS n 1 197 PRO n 1 198 GLU n 1 199 GLN n 1 200 SER n 1 201 GLU n 1 202 ILE n 1 203 SER n 1 204 PRO n 1 205 ASP n 1 206 PHE n 1 207 ASP n 1 208 LEU n 1 209 GLU n 1 210 LYS n 1 211 ILE n 1 212 TYR n 1 213 ASP n 1 214 TYR n 1 215 ILE n 1 216 ARG n 1 217 MSE n 1 218 LEU n 1 219 ASP n 1 220 GLY n 1 221 GLU n 1 222 GLY n 1 223 TYR n 1 224 PRO n 1 225 ARG n 1 226 ALA n 1 227 PHE n 1 228 ILE n 1 229 LYS n 1 230 TYR n 1 231 GLY n 1 232 LYS n 1 233 TYR n 1 234 ARG n 1 235 LEU n 1 236 GLU n 1 237 PHE n 1 238 SER n 1 239 ARG n 1 240 ALA n 1 241 SER n 1 242 MSE n 1 243 LYS n 1 244 ASN n 1 245 GLY n 1 246 LYS n 1 247 ILE n 1 248 ILE n 1 249 ALA n 1 250 ASP n 1 251 VAL n 1 252 GLU n 1 253 ILE n 1 254 ILE n 1 255 GLU n 1 256 GLY n 1 257 ASP n 1 258 GLU n 1 259 ASN n 1 260 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name bacteria _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium thermocellum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 27405 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name bacteria _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code ZP_00313263 _struct_ref.pdbx_db_accession 48859327 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNIIIATTKSWNIKNAQKFKKENESKYNTTIITNKDELTFEKVKLINPEYILFPHWSWIIPKEIFENFTCVVFHMTDLPF GRGGSPLQNLIERGIKKTKISAIKVDGGIDTGDIFFKRDLDLYGTAEEIFMRASKIIFNDMIPELLTKRPVPQKQEGEAT VFQRRKPEQSEISPDFDLEKIYDYIRMLDGEGYPRAFIKYGKYRLEFSRASMKNGKIIADVEIIEGDENE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XG9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 31 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 260 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 48859327 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 230 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 230 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1XG9 MSE A 1 ? GB 48859327 ? ? 'HIS TAG' -29 1 1 1XG9 GLY A 2 ? GB 48859327 ? ? 'HIS TAG' -28 2 1 1XG9 SER A 3 ? GB 48859327 ? ? 'HIS TAG' -27 3 1 1XG9 SER A 4 ? GB 48859327 ? ? 'HIS TAG' -26 4 1 1XG9 HIS A 5 ? GB 48859327 ? ? 'HIS TAG' -25 5 1 1XG9 HIS A 6 ? GB 48859327 ? ? 'HIS TAG' -24 6 1 1XG9 HIS A 7 ? GB 48859327 ? ? 'HIS TAG' -23 7 1 1XG9 HIS A 8 ? GB 48859327 ? ? 'HIS TAG' -22 8 1 1XG9 HIS A 9 ? GB 48859327 ? ? 'HIS TAG' -21 9 1 1XG9 HIS A 10 ? GB 48859327 ? ? 'HIS TAG' -20 10 1 1XG9 SER A 11 ? GB 48859327 ? ? 'HIS TAG' -19 11 1 1XG9 SER A 12 ? GB 48859327 ? ? 'HIS TAG' -18 12 1 1XG9 GLY A 13 ? GB 48859327 ? ? 'HIS TAG' -17 13 1 1XG9 LEU A 14 ? GB 48859327 ? ? 'HIS TAG' -16 14 1 1XG9 VAL A 15 ? GB 48859327 ? ? 'HIS TAG' -15 15 1 1XG9 PRO A 16 ? GB 48859327 ? ? 'HIS TAG' -14 16 1 1XG9 ARG A 17 ? GB 48859327 ? ? 'HIS TAG' -13 17 1 1XG9 GLY A 18 ? GB 48859327 ? ? 'HIS TAG' -12 18 1 1XG9 SER A 19 ? GB 48859327 ? ? 'HIS TAG' -11 19 1 1XG9 GLN A 20 ? GB 48859327 ? ? 'HIS TAG' -10 20 1 1XG9 SER A 21 ? GB 48859327 ? ? 'HIS TAG' -9 21 1 1XG9 THR A 22 ? GB 48859327 ? ? 'HIS TAG' -8 22 1 1XG9 SER A 23 ? GB 48859327 ? ? 'HIS TAG' -7 23 1 1XG9 LEU A 24 ? GB 48859327 ? ? 'HIS TAG' -6 24 1 1XG9 TYR A 25 ? GB 48859327 ? ? 'HIS TAG' -5 25 1 1XG9 LYS A 26 ? GB 48859327 ? ? 'HIS TAG' -4 26 1 1XG9 LYS A 27 ? GB 48859327 ? ? 'HIS TAG' -3 27 1 1XG9 ALA A 28 ? GB 48859327 ? ? 'HIS TAG' -2 28 1 1XG9 GLY A 29 ? GB 48859327 ? ? 'HIS TAG' -1 29 1 1XG9 LEU A 30 ? GB 48859327 ? ? 'HIS TAG' 0 30 1 1XG9 MSE A 31 ? GB 48859327 MET 1 'MODIFIED RESIDUE' 1 31 1 1XG9 MSE A 105 ? GB 48859327 MET 75 'MODIFIED RESIDUE' 75 32 1 1XG9 MSE A 161 ? GB 48859327 MET 131 'MODIFIED RESIDUE' 131 33 1 1XG9 MSE A 171 ? GB 48859327 MET 141 'MODIFIED RESIDUE' 141 34 1 1XG9 MSE A 217 ? GB 48859327 MET 187 'MODIFIED RESIDUE' 187 35 1 1XG9 MSE A 242 ? GB 48859327 MET 212 'MODIFIED RESIDUE' 212 36 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1XG9 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.13 _exptl_crystal.density_percent_sol 60.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARCCD225 _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9794 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS beamline 22ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22ID _diffrn_source.pdbx_wavelength 0.9794 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1XG9 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 1.980 _reflns.number_obs 27555 _reflns.number_all ? _reflns.percent_possible_obs 98.3 _reflns.pdbx_Rmerge_I_obs 0.118 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_netI_over_sigmaI ? # _reflns_shell.d_res_high 1.98 _reflns_shell.d_res_low 2.05 _reflns_shell.percent_possible_all 83.6 _reflns_shell.Rmerge_I_obs 0.535 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1XG9 _refine.ls_number_reflns_obs 24816 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.80 _refine.ls_d_res_high 2.05 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.19117 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19 _refine.ls_R_factor_R_free 0.216 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.924 _refine.ls_number_reflns_R_free 1222 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.950 _refine.correlation_coeff_Fo_to_Fc_free 0.938 _refine.B_iso_mean 31.34 _refine.aniso_B[1][1] 0.04200 _refine.aniso_B[2][2] 0.04200 _refine.aniso_B[3][3] -0.08300 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH & HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.135 _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1804 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 59 _refine_hist.number_atoms_total 1864 _refine_hist.d_res_high 2.05 _refine_hist.d_res_low 30.80 _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.014 0.022 ? 1845 'X-RAY DIFFRACTION' ? r_bond_other_d 0.000 0.020 ? 1697 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.333 1.960 ? 2494 'X-RAY DIFFRACTION' ? r_angle_other_deg 3.678 3.000 ? 3937 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.351 5.000 ? 226 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 33.043 24.146 ? 82 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 10.957 15.000 ? 326 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 17.629 15.000 ? 10 'X-RAY DIFFRACTION' ? r_chiral_restr 0.088 0.200 ? 275 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 2030 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.008 0.020 ? 381 'X-RAY DIFFRACTION' ? r_nbd_refined 0.203 0.200 ? 281 'X-RAY DIFFRACTION' ? r_nbd_other 0.221 0.200 ? 1383 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.176 0.200 ? 884 'X-RAY DIFFRACTION' ? r_nbtor_other 0.107 0.200 ? 816 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.110 0.200 ? 48 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.238 0.200 ? 7 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.252 0.200 ? 36 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.151 0.200 ? 6 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.382 1.500 ? 1130 'X-RAY DIFFRACTION' ? r_mcbond_other 0.000 1.500 ? 459 'X-RAY DIFFRACTION' ? r_mcangle_it 3.455 2.000 ? 1834 'X-RAY DIFFRACTION' ? r_scbond_it 2.996 3.000 ? 715 'X-RAY DIFFRACTION' ? r_scangle_it 4.318 4.500 ? 660 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.05 _refine_ls_shell.d_res_low 2.10 _refine_ls_shell.number_reflns_R_work 1684 _refine_ls_shell.R_factor_R_work 0.183 _refine_ls_shell.percent_reflns_obs 99.83 _refine_ls_shell.R_factor_R_free 0.226 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 94 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1XG9 _struct.title 'Methionyl-tRNA formyltransferase from Clostridium thermocellum' _struct.pdbx_descriptor 'Methionyl-tRNA formyltransferase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;Methionyl-tRNA formyltransferase, Southeast Collaboratory for Structural Genomics, SECSG, Clostridium thermocellum, protein structure initiative, PSI, transferase ; _struct_keywords.entry_id 1XG9 _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details unknown _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 39 ? ASN A 53 ? LYS A 9 ASN A 23 1 ? 15 HELX_P HELX_P2 2 ASN A 64 ? LEU A 68 ? ASN A 34 LEU A 38 5 ? 5 HELX_P HELX_P3 3 THR A 69 ? ASN A 77 ? THR A 39 ASN A 47 1 ? 9 HELX_P HELX_P4 4 PRO A 91 ? GLU A 96 ? PRO A 61 GLU A 66 1 ? 6 HELX_P HELX_P5 5 SER A 115 ? ARG A 123 ? SER A 85 ARG A 93 1 ? 9 HELX_P HELX_P6 6 THR A 155 ? ASP A 170 ? THR A 125 ASP A 140 1 ? 16 HELX_P HELX_P7 7 ASP A 170 ? ARG A 179 ? ASP A 140 ARG A 149 1 ? 10 HELX_P HELX_P8 8 LYS A 196 ? GLU A 201 ? LYS A 166 GLU A 171 5 ? 6 HELX_P HELX_P9 9 ASP A 207 ? LEU A 218 ? ASP A 177 LEU A 188 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 108 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 78 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 109 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 79 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.48 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 57 ? ILE A 62 ? TYR A 27 ILE A 32 A 2 MSE A 31 ? ALA A 36 ? MSE A 1 ALA A 6 A 3 TYR A 80 ? PHE A 83 ? TYR A 50 PHE A 53 A 4 CYS A 100 ? HIS A 104 ? CYS A 70 HIS A 74 A 5 LYS A 127 ? LYS A 134 ? LYS A 97 LYS A 104 A 6 ILE A 144 ? ASP A 151 ? ILE A 114 ASP A 121 B 1 ARG A 112 ? GLY A 113 ? ARG A 82 GLY A 83 B 2 VAL A 191 ? PHE A 192 ? VAL A 161 PHE A 162 C 1 PHE A 227 ? TYR A 230 ? PHE A 197 TYR A 200 C 2 TYR A 233 ? LYS A 243 ? TYR A 203 LYS A 213 C 3 LYS A 246 ? ILE A 254 ? LYS A 216 ILE A 224 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASN A 58 ? O ASN A 28 N ILE A 33 ? N ILE A 3 A 2 3 N ILE A 34 ? N ILE A 4 O LEU A 82 ? O LEU A 52 A 3 4 N ILE A 81 ? N ILE A 51 O VAL A 101 ? O VAL A 71 A 4 5 N HIS A 104 ? N HIS A 74 O SER A 131 ? O SER A 101 A 5 6 N ILE A 130 ? N ILE A 100 O ARG A 148 ? O ARG A 118 B 1 2 N ARG A 112 ? N ARG A 82 O PHE A 192 ? O PHE A 162 C 1 2 N ILE A 228 ? N ILE A 198 O LEU A 235 ? O LEU A 205 C 2 3 N LYS A 243 ? N LYS A 213 O LYS A 246 ? O LYS A 216 # _atom_sites.entry_id 1XG9 _atom_sites.fract_transf_matrix[1][1] 0.011710 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011710 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009590 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -29 ? ? ? A . n A 1 2 GLY 2 -28 ? ? ? A . n A 1 3 SER 3 -27 ? ? ? A . n A 1 4 SER 4 -26 ? ? ? A . n A 1 5 HIS 5 -25 ? ? ? A . n A 1 6 HIS 6 -24 ? ? ? A . n A 1 7 HIS 7 -23 ? ? ? A . n A 1 8 HIS 8 -22 ? ? ? A . n A 1 9 HIS 9 -21 ? ? ? A . n A 1 10 HIS 10 -20 ? ? ? A . n A 1 11 SER 11 -19 ? ? ? A . n A 1 12 SER 12 -18 ? ? ? A . n A 1 13 GLY 13 -17 ? ? ? A . n A 1 14 LEU 14 -16 ? ? ? A . n A 1 15 VAL 15 -15 ? ? ? A . n A 1 16 PRO 16 -14 ? ? ? A . n A 1 17 ARG 17 -13 ? ? ? A . n A 1 18 GLY 18 -12 ? ? ? A . n A 1 19 SER 19 -11 ? ? ? A . n A 1 20 GLN 20 -10 ? ? ? A . n A 1 21 SER 21 -9 ? ? ? A . n A 1 22 THR 22 -8 ? ? ? A . n A 1 23 SER 23 -7 ? ? ? A . n A 1 24 LEU 24 -6 ? ? ? A . n A 1 25 TYR 25 -5 ? ? ? A . n A 1 26 LYS 26 -4 ? ? ? A . n A 1 27 LYS 27 -3 ? ? ? A . n A 1 28 ALA 28 -2 ? ? ? A . n A 1 29 GLY 29 -1 ? ? ? A . n A 1 30 LEU 30 0 0 LEU LEU A . n A 1 31 MSE 31 1 1 MSE MSE A . n A 1 32 ASN 32 2 2 ASN ASN A . n A 1 33 ILE 33 3 3 ILE ILE A . n A 1 34 ILE 34 4 4 ILE ILE A . n A 1 35 ILE 35 5 5 ILE ILE A . n A 1 36 ALA 36 6 6 ALA ALA A . n A 1 37 THR 37 7 7 THR THR A . n A 1 38 THR 38 8 8 THR THR A . n A 1 39 LYS 39 9 9 LYS LYS A . n A 1 40 SER 40 10 10 SER SER A . n A 1 41 TRP 41 11 11 TRP TRP A . n A 1 42 ASN 42 12 12 ASN ASN A . n A 1 43 ILE 43 13 13 ILE ILE A . n A 1 44 LYS 44 14 14 LYS LYS A . n A 1 45 ASN 45 15 15 ASN ASN A . n A 1 46 ALA 46 16 16 ALA ALA A . n A 1 47 GLN 47 17 17 GLN GLN A . n A 1 48 LYS 48 18 18 LYS LYS A . n A 1 49 PHE 49 19 19 PHE PHE A . n A 1 50 LYS 50 20 20 LYS LYS A . n A 1 51 LYS 51 21 21 LYS LYS A . n A 1 52 GLU 52 22 22 GLU GLU A . n A 1 53 ASN 53 23 23 ASN ASN A . n A 1 54 GLU 54 24 24 GLU GLU A . n A 1 55 SER 55 25 25 SER SER A . n A 1 56 LYS 56 26 26 LYS LYS A . n A 1 57 TYR 57 27 27 TYR TYR A . n A 1 58 ASN 58 28 28 ASN ASN A . n A 1 59 THR 59 29 29 THR THR A . n A 1 60 THR 60 30 30 THR THR A . n A 1 61 ILE 61 31 31 ILE ILE A . n A 1 62 ILE 62 32 32 ILE ILE A . n A 1 63 THR 63 33 33 THR THR A . n A 1 64 ASN 64 34 34 ASN ASN A . n A 1 65 LYS 65 35 35 LYS LYS A . n A 1 66 ASP 66 36 36 ASP ASP A . n A 1 67 GLU 67 37 37 GLU GLU A . n A 1 68 LEU 68 38 38 LEU LEU A . n A 1 69 THR 69 39 39 THR THR A . n A 1 70 PHE 70 40 40 PHE PHE A . n A 1 71 GLU 71 41 41 GLU GLU A . n A 1 72 LYS 72 42 42 LYS LYS A . n A 1 73 VAL 73 43 43 VAL VAL A . n A 1 74 LYS 74 44 44 LYS LYS A . n A 1 75 LEU 75 45 45 LEU LEU A . n A 1 76 ILE 76 46 46 ILE ILE A . n A 1 77 ASN 77 47 47 ASN ASN A . n A 1 78 PRO 78 48 48 PRO PRO A . n A 1 79 GLU 79 49 49 GLU GLU A . n A 1 80 TYR 80 50 50 TYR TYR A . n A 1 81 ILE 81 51 51 ILE ILE A . n A 1 82 LEU 82 52 52 LEU LEU A . n A 1 83 PHE 83 53 53 PHE PHE A . n A 1 84 PRO 84 54 54 PRO PRO A . n A 1 85 HIS 85 55 55 HIS HIS A . n A 1 86 TRP 86 56 56 TRP TRP A . n A 1 87 SER 87 57 57 SER SER A . n A 1 88 TRP 88 58 58 TRP TRP A . n A 1 89 ILE 89 59 59 ILE ILE A . n A 1 90 ILE 90 60 60 ILE ILE A . n A 1 91 PRO 91 61 61 PRO PRO A . n A 1 92 LYS 92 62 62 LYS LYS A . n A 1 93 GLU 93 63 63 GLU GLU A . n A 1 94 ILE 94 64 64 ILE ILE A . n A 1 95 PHE 95 65 65 PHE PHE A . n A 1 96 GLU 96 66 66 GLU GLU A . n A 1 97 ASN 97 67 67 ASN ASN A . n A 1 98 PHE 98 68 68 PHE PHE A . n A 1 99 THR 99 69 69 THR THR A . n A 1 100 CYS 100 70 70 CYS CYS A . n A 1 101 VAL 101 71 71 VAL VAL A . n A 1 102 VAL 102 72 72 VAL VAL A . n A 1 103 PHE 103 73 73 PHE PHE A . n A 1 104 HIS 104 74 74 HIS HIS A . n A 1 105 MSE 105 75 75 MSE MSE A . n A 1 106 THR 106 76 76 THR THR A . n A 1 107 ASP 107 77 77 ASP ASP A . n A 1 108 LEU 108 78 78 LEU LEU A . n A 1 109 PRO 109 79 79 PRO PRO A . n A 1 110 PHE 110 80 80 PHE PHE A . n A 1 111 GLY 111 81 81 GLY GLY A . n A 1 112 ARG 112 82 82 ARG ARG A . n A 1 113 GLY 113 83 83 GLY GLY A . n A 1 114 GLY 114 84 84 GLY GLY A . n A 1 115 SER 115 85 85 SER SER A . n A 1 116 PRO 116 86 86 PRO PRO A . n A 1 117 LEU 117 87 87 LEU LEU A . n A 1 118 GLN 118 88 88 GLN GLN A . n A 1 119 ASN 119 89 89 ASN ASN A . n A 1 120 LEU 120 90 90 LEU LEU A . n A 1 121 ILE 121 91 91 ILE ILE A . n A 1 122 GLU 122 92 92 GLU GLU A . n A 1 123 ARG 123 93 93 ARG ARG A . n A 1 124 GLY 124 94 94 GLY GLY A . n A 1 125 ILE 125 95 95 ILE ILE A . n A 1 126 LYS 126 96 96 LYS LYS A . n A 1 127 LYS 127 97 97 LYS LYS A . n A 1 128 THR 128 98 98 THR THR A . n A 1 129 LYS 129 99 99 LYS LYS A . n A 1 130 ILE 130 100 100 ILE ILE A . n A 1 131 SER 131 101 101 SER SER A . n A 1 132 ALA 132 102 102 ALA ALA A . n A 1 133 ILE 133 103 103 ILE ILE A . n A 1 134 LYS 134 104 104 LYS LYS A . n A 1 135 VAL 135 105 105 VAL VAL A . n A 1 136 ASP 136 106 106 ASP ASP A . n A 1 137 GLY 137 107 107 GLY GLY A . n A 1 138 GLY 138 108 108 GLY GLY A . n A 1 139 ILE 139 109 109 ILE ILE A . n A 1 140 ASP 140 110 110 ASP ASP A . n A 1 141 THR 141 111 111 THR THR A . n A 1 142 GLY 142 112 112 GLY GLY A . n A 1 143 ASP 143 113 113 ASP ASP A . n A 1 144 ILE 144 114 114 ILE ILE A . n A 1 145 PHE 145 115 115 PHE PHE A . n A 1 146 PHE 146 116 116 PHE PHE A . n A 1 147 LYS 147 117 117 LYS LYS A . n A 1 148 ARG 148 118 118 ARG ARG A . n A 1 149 ASP 149 119 119 ASP ASP A . n A 1 150 LEU 150 120 120 LEU LEU A . n A 1 151 ASP 151 121 121 ASP ASP A . n A 1 152 LEU 152 122 122 LEU LEU A . n A 1 153 TYR 153 123 123 TYR TYR A . n A 1 154 GLY 154 124 124 GLY GLY A . n A 1 155 THR 155 125 125 THR THR A . n A 1 156 ALA 156 126 126 ALA ALA A . n A 1 157 GLU 157 127 127 GLU GLU A . n A 1 158 GLU 158 128 128 GLU GLU A . n A 1 159 ILE 159 129 129 ILE ILE A . n A 1 160 PHE 160 130 130 PHE PHE A . n A 1 161 MSE 161 131 131 MSE MSE A . n A 1 162 ARG 162 132 132 ARG ARG A . n A 1 163 ALA 163 133 133 ALA ALA A . n A 1 164 SER 164 134 134 SER SER A . n A 1 165 LYS 165 135 135 LYS LYS A . n A 1 166 ILE 166 136 136 ILE ILE A . n A 1 167 ILE 167 137 137 ILE ILE A . n A 1 168 PHE 168 138 138 PHE PHE A . n A 1 169 ASN 169 139 139 ASN ASN A . n A 1 170 ASP 170 140 140 ASP ASP A . n A 1 171 MSE 171 141 141 MSE MSE A . n A 1 172 ILE 172 142 142 ILE ILE A . n A 1 173 PRO 173 143 143 PRO PRO A . n A 1 174 GLU 174 144 144 GLU GLU A . n A 1 175 LEU 175 145 145 LEU LEU A . n A 1 176 LEU 176 146 146 LEU LEU A . n A 1 177 THR 177 147 147 THR THR A . n A 1 178 LYS 178 148 148 LYS LYS A . n A 1 179 ARG 179 149 149 ARG ARG A . n A 1 180 PRO 180 150 150 PRO PRO A . n A 1 181 VAL 181 151 151 VAL VAL A . n A 1 182 PRO 182 152 152 PRO PRO A . n A 1 183 GLN 183 153 153 GLN GLN A . n A 1 184 LYS 184 154 154 LYS LYS A . n A 1 185 GLN 185 155 155 GLN GLN A . n A 1 186 GLU 186 156 156 GLU GLU A . n A 1 187 GLY 187 157 157 GLY GLY A . n A 1 188 GLU 188 158 158 GLU GLU A . n A 1 189 ALA 189 159 159 ALA ALA A . n A 1 190 THR 190 160 160 THR THR A . n A 1 191 VAL 191 161 161 VAL VAL A . n A 1 192 PHE 192 162 162 PHE PHE A . n A 1 193 GLN 193 163 163 GLN GLN A . n A 1 194 ARG 194 164 164 ARG ARG A . n A 1 195 ARG 195 165 165 ARG ARG A . n A 1 196 LYS 196 166 166 LYS LYS A . n A 1 197 PRO 197 167 167 PRO PRO A . n A 1 198 GLU 198 168 168 GLU GLU A . n A 1 199 GLN 199 169 169 GLN GLN A . n A 1 200 SER 200 170 170 SER SER A . n A 1 201 GLU 201 171 171 GLU GLU A . n A 1 202 ILE 202 172 172 ILE ILE A . n A 1 203 SER 203 173 173 SER SER A . n A 1 204 PRO 204 174 174 PRO PRO A . n A 1 205 ASP 205 175 175 ASP ASP A . n A 1 206 PHE 206 176 176 PHE PHE A . n A 1 207 ASP 207 177 177 ASP ASP A . n A 1 208 LEU 208 178 178 LEU LEU A . n A 1 209 GLU 209 179 179 GLU GLU A . n A 1 210 LYS 210 180 180 LYS LYS A . n A 1 211 ILE 211 181 181 ILE ILE A . n A 1 212 TYR 212 182 182 TYR TYR A . n A 1 213 ASP 213 183 183 ASP ASP A . n A 1 214 TYR 214 184 184 TYR TYR A . n A 1 215 ILE 215 185 185 ILE ILE A . n A 1 216 ARG 216 186 186 ARG ARG A . n A 1 217 MSE 217 187 187 MSE MSE A . n A 1 218 LEU 218 188 188 LEU LEU A . n A 1 219 ASP 219 189 189 ASP ASP A . n A 1 220 GLY 220 190 190 GLY GLY A . n A 1 221 GLU 221 191 191 GLU GLU A . n A 1 222 GLY 222 192 192 GLY GLY A . n A 1 223 TYR 223 193 193 TYR TYR A . n A 1 224 PRO 224 194 194 PRO PRO A . n A 1 225 ARG 225 195 195 ARG ARG A . n A 1 226 ALA 226 196 196 ALA ALA A . n A 1 227 PHE 227 197 197 PHE PHE A . n A 1 228 ILE 228 198 198 ILE ILE A . n A 1 229 LYS 229 199 199 LYS LYS A . n A 1 230 TYR 230 200 200 TYR TYR A . n A 1 231 GLY 231 201 201 GLY GLY A . n A 1 232 LYS 232 202 202 LYS LYS A . n A 1 233 TYR 233 203 203 TYR TYR A . n A 1 234 ARG 234 204 204 ARG ARG A . n A 1 235 LEU 235 205 205 LEU LEU A . n A 1 236 GLU 236 206 206 GLU GLU A . n A 1 237 PHE 237 207 207 PHE PHE A . n A 1 238 SER 238 208 208 SER SER A . n A 1 239 ARG 239 209 209 ARG ARG A . n A 1 240 ALA 240 210 210 ALA ALA A . n A 1 241 SER 241 211 211 SER SER A . n A 1 242 MSE 242 212 212 MSE MSE A . n A 1 243 LYS 243 213 213 LYS LYS A . n A 1 244 ASN 244 214 214 ASN ASN A . n A 1 245 GLY 245 215 215 GLY GLY A . n A 1 246 LYS 246 216 216 LYS LYS A . n A 1 247 ILE 247 217 217 ILE ILE A . n A 1 248 ILE 248 218 218 ILE ILE A . n A 1 249 ALA 249 219 219 ALA ALA A . n A 1 250 ASP 250 220 220 ASP ASP A . n A 1 251 VAL 251 221 221 VAL VAL A . n A 1 252 GLU 252 222 222 GLU GLU A . n A 1 253 ILE 253 223 223 ILE ILE A . n A 1 254 ILE 254 224 224 ILE ILE A . n A 1 255 GLU 255 225 225 GLU GLU A . n A 1 256 GLY 256 226 226 GLY GLY A . n A 1 257 ASP 257 227 ? ? ? A . n A 1 258 GLU 258 228 ? ? ? A . n A 1 259 ASN 259 229 ? ? ? A . n A 1 260 GLU 260 230 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Southeast Collaboratory for Structural Genomics' _pdbx_SG_project.initial_of_center SECSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 0 0 CL CL ? . C 3 HOH 1 1 1 HOH HOH ? . C 3 HOH 2 2 2 HOH HOH ? . C 3 HOH 3 3 3 HOH HOH ? . C 3 HOH 4 4 4 HOH HOH ? . C 3 HOH 5 5 5 HOH HOH ? . C 3 HOH 6 6 6 HOH HOH ? . C 3 HOH 7 7 7 HOH HOH ? . C 3 HOH 8 8 8 HOH HOH ? . C 3 HOH 9 9 9 HOH HOH ? . C 3 HOH 10 10 10 HOH HOH ? . C 3 HOH 11 11 11 HOH HOH ? . C 3 HOH 12 12 12 HOH HOH ? . C 3 HOH 13 13 13 HOH HOH ? . C 3 HOH 14 14 14 HOH HOH ? . C 3 HOH 15 15 15 HOH HOH ? . C 3 HOH 16 16 16 HOH HOH ? . C 3 HOH 17 17 17 HOH HOH ? . C 3 HOH 18 18 18 HOH HOH ? . C 3 HOH 19 19 19 HOH HOH ? . C 3 HOH 20 20 20 HOH HOH ? . C 3 HOH 21 21 21 HOH HOH ? . C 3 HOH 22 22 22 HOH HOH ? . C 3 HOH 23 23 23 HOH HOH ? . C 3 HOH 24 24 24 HOH HOH ? . C 3 HOH 25 25 25 HOH HOH ? . C 3 HOH 26 26 26 HOH HOH ? . C 3 HOH 27 27 27 HOH HOH ? . C 3 HOH 28 28 28 HOH HOH ? . C 3 HOH 29 29 29 HOH HOH ? . C 3 HOH 30 30 30 HOH HOH ? . C 3 HOH 31 31 31 HOH HOH ? . C 3 HOH 32 32 32 HOH HOH ? . C 3 HOH 33 33 33 HOH HOH ? . C 3 HOH 34 34 34 HOH HOH ? . C 3 HOH 35 35 35 HOH HOH ? . C 3 HOH 36 36 36 HOH HOH ? . C 3 HOH 37 37 37 HOH HOH ? . C 3 HOH 38 38 38 HOH HOH ? . C 3 HOH 39 39 39 HOH HOH ? . C 3 HOH 40 40 40 HOH HOH ? . C 3 HOH 41 41 41 HOH HOH ? . C 3 HOH 42 42 42 HOH HOH ? . C 3 HOH 43 43 43 HOH HOH ? . C 3 HOH 44 44 44 HOH HOH ? . C 3 HOH 45 45 45 HOH HOH ? . C 3 HOH 46 46 46 HOH HOH ? . C 3 HOH 47 47 47 HOH HOH ? . C 3 HOH 48 48 48 HOH HOH ? . C 3 HOH 49 49 49 HOH HOH ? . C 3 HOH 50 50 50 HOH HOH ? . C 3 HOH 51 51 51 HOH HOH ? . C 3 HOH 52 52 52 HOH HOH ? . C 3 HOH 53 53 53 HOH HOH ? . C 3 HOH 54 54 54 HOH HOH ? . C 3 HOH 55 55 55 HOH HOH ? . C 3 HOH 56 56 56 HOH HOH ? . C 3 HOH 57 57 57 HOH HOH ? . C 3 HOH 58 58 58 HOH HOH ? . C 3 HOH 59 59 59 HOH HOH ? . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-23 2 'Structure model' 1 1 2005-05-03 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 33.2850 _pdbx_refine_tls.origin_y 27.8800 _pdbx_refine_tls.origin_z 31.4480 _pdbx_refine_tls.T[1][1] -0.1139 _pdbx_refine_tls.T[2][2] 0.0175 _pdbx_refine_tls.T[3][3] -0.0111 _pdbx_refine_tls.T[1][2] -0.0048 _pdbx_refine_tls.T[1][3] 0.0099 _pdbx_refine_tls.T[2][3] -0.0867 _pdbx_refine_tls.L[1][1] 1.1965 _pdbx_refine_tls.L[2][2] 0.8696 _pdbx_refine_tls.L[3][3] 0.9431 _pdbx_refine_tls.L[1][2] 0.3987 _pdbx_refine_tls.L[1][3] 0.7755 _pdbx_refine_tls.L[2][3] 0.1698 _pdbx_refine_tls.S[1][1] -0.0127 _pdbx_refine_tls.S[1][2] 0.2947 _pdbx_refine_tls.S[1][3] -0.1379 _pdbx_refine_tls.S[2][1] -0.0823 _pdbx_refine_tls.S[2][2] 0.0519 _pdbx_refine_tls.S[2][3] 0.0265 _pdbx_refine_tls.S[3][1] 0.1228 _pdbx_refine_tls.S[3][2] 0.0405 _pdbx_refine_tls.S[3][3] -0.0391 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 30 _pdbx_refine_tls_group.beg_auth_seq_id 0 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 256 _pdbx_refine_tls_group.end_auth_seq_id 226 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_phasing_MAD_shell.d_res_low _pdbx_phasing_MAD_shell.d_res_high _pdbx_phasing_MAD_shell.reflns _pdbx_phasing_MAD_shell.fom 20.000 8.52 766 0.39 8.52 5.54 1195 0.42 5.54 4.38 1471 0.40 4.38 3.74 1720 0.38 3.74 3.31 1903 0.41 3.31 3.00 2065 0.42 3.00 2.77 2189 0.40 2.77 2.58 2280 0.36 # _pdbx_phasing_dm.entry_id 1XG9 _pdbx_phasing_dm.fom_acentric 0.59 _pdbx_phasing_dm.fom_centric 0.51 _pdbx_phasing_dm.fom 0.58 _pdbx_phasing_dm.reflns_acentric 14644 _pdbx_phasing_dm.reflns_centric 2483 _pdbx_phasing_dm.reflns 17127 # loop_ _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 19.757 6.6 0.89 0.65 0.89 525 288 813 6.6 4.1 0.88 0.70 0.84 1917 522 2439 4.1 3.3 0.81 0.65 0.79 2489 479 2968 3.3 2.9 0.71 0.50 0.68 2553 381 2934 2.9 2.5 0.51 0.32 0.49 4459 543 5002 2.5 2.3 0.14 0.17 0.14 2701 270 2971 # _phasing.method SAD # _phasing_MAD.entry_id 1XG9 _phasing_MAD.pdbx_d_res_high 2.500 _phasing_MAD.pdbx_d_res_low 20.000 _phasing_MAD.pdbx_reflns 13589 _phasing_MAD.pdbx_fom 0.40 # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal HKL/scalepack . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data processing' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SOLVE 2.03 20-Sept-2002 program 'Tom Terwilliger' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 2 RESOLVE 2.03 10-Aug-2002 program 'Terwilliger, T. C' terwilliger@LANL.gov 'density modification' http://www.solve.lanl.gov/ ? ? 3 REFMAC5 refmac_5.2.0003 24/04/2001 program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran ? 4 PDB_EXTRACT 1.0 02/20/2004 program H.Yang sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C/C++ ? 5 # _pdbx_database_remark.id 300 _pdbx_database_remark.text ;BIOMOLECULE: THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 1 CHAIN(S). THE BIOLOGICAL UNIT IS UNKNOWN. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 9 ? ? 84.19 134.74 2 1 MSE A 75 ? ? -82.89 38.17 3 1 SER A 85 ? ? 36.81 53.98 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 18 ? CD ? A LYS 48 CD 2 1 Y 1 A LYS 18 ? CE ? A LYS 48 CE 3 1 Y 1 A LYS 18 ? NZ ? A LYS 48 NZ 4 1 Y 1 A LYS 21 ? CG ? A LYS 51 CG 5 1 Y 1 A LYS 21 ? CD ? A LYS 51 CD 6 1 Y 1 A LYS 21 ? CE ? A LYS 51 CE 7 1 Y 1 A LYS 21 ? NZ ? A LYS 51 NZ 8 1 Y 1 A GLU 22 ? CD ? A GLU 52 CD 9 1 Y 1 A GLU 22 ? OE1 ? A GLU 52 OE1 10 1 Y 1 A GLU 22 ? OE2 ? A GLU 52 OE2 11 1 Y 1 A GLU 24 ? CD ? A GLU 54 CD 12 1 Y 1 A GLU 24 ? OE1 ? A GLU 54 OE1 13 1 Y 1 A GLU 24 ? OE2 ? A GLU 54 OE2 14 1 Y 1 A LYS 26 ? CE ? A LYS 56 CE 15 1 Y 1 A LYS 26 ? NZ ? A LYS 56 NZ 16 1 Y 1 A GLU 49 ? CD ? A GLU 79 CD 17 1 Y 1 A GLU 49 ? OE1 ? A GLU 79 OE1 18 1 Y 1 A GLU 49 ? OE2 ? A GLU 79 OE2 19 1 Y 1 A SER 57 ? CB ? A SER 87 CB 20 1 Y 1 A SER 57 ? OG ? A SER 87 OG 21 1 Y 1 A LYS 62 ? CG ? A LYS 92 CG 22 1 Y 1 A LYS 62 ? CD ? A LYS 92 CD 23 1 Y 1 A LYS 62 ? CE ? A LYS 92 CE 24 1 Y 1 A LYS 62 ? NZ ? A LYS 92 NZ 25 1 Y 1 A GLU 63 ? CG ? A GLU 93 CG 26 1 Y 1 A GLU 63 ? CD ? A GLU 93 CD 27 1 Y 1 A GLU 63 ? OE1 ? A GLU 93 OE1 28 1 Y 1 A GLU 63 ? OE2 ? A GLU 93 OE2 29 1 Y 1 A LYS 96 ? CG ? A LYS 126 CG 30 1 Y 1 A LYS 96 ? CD ? A LYS 126 CD 31 1 Y 1 A LYS 96 ? CE ? A LYS 126 CE 32 1 Y 1 A LYS 96 ? NZ ? A LYS 126 NZ 33 1 Y 1 A LYS 97 ? CD ? A LYS 127 CD 34 1 Y 1 A LYS 97 ? CE ? A LYS 127 CE 35 1 Y 1 A LYS 97 ? NZ ? A LYS 127 NZ 36 1 Y 1 A LYS 154 ? CG ? A LYS 184 CG 37 1 Y 1 A LYS 154 ? CD ? A LYS 184 CD 38 1 Y 1 A LYS 154 ? CE ? A LYS 184 CE 39 1 Y 1 A LYS 154 ? NZ ? A LYS 184 NZ 40 1 Y 1 A GLU 156 ? CG ? A GLU 186 CG 41 1 Y 1 A GLU 156 ? CD ? A GLU 186 CD 42 1 Y 1 A GLU 156 ? OE1 ? A GLU 186 OE1 43 1 Y 1 A GLU 156 ? OE2 ? A GLU 186 OE2 44 1 Y 1 A GLU 158 ? CD ? A GLU 188 CD 45 1 Y 1 A GLU 158 ? OE1 ? A GLU 188 OE1 46 1 Y 1 A GLU 158 ? OE2 ? A GLU 188 OE2 47 1 Y 1 A ARG 164 ? CD ? A ARG 194 CD 48 1 Y 1 A ARG 164 ? NE ? A ARG 194 NE 49 1 Y 1 A ARG 164 ? CZ ? A ARG 194 CZ 50 1 Y 1 A ARG 164 ? NH1 ? A ARG 194 NH1 51 1 Y 1 A ARG 164 ? NH2 ? A ARG 194 NH2 52 1 Y 1 A LYS 166 ? CD ? A LYS 196 CD 53 1 Y 1 A LYS 166 ? CE ? A LYS 196 CE 54 1 Y 1 A LYS 166 ? NZ ? A LYS 196 NZ 55 1 Y 1 A LYS 202 ? CG ? A LYS 232 CG 56 1 Y 1 A LYS 202 ? CD ? A LYS 232 CD 57 1 Y 1 A LYS 202 ? CE ? A LYS 232 CE 58 1 Y 1 A LYS 202 ? NZ ? A LYS 232 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -29 ? A MSE 1 2 1 Y 1 A GLY -28 ? A GLY 2 3 1 Y 1 A SER -27 ? A SER 3 4 1 Y 1 A SER -26 ? A SER 4 5 1 Y 1 A HIS -25 ? A HIS 5 6 1 Y 1 A HIS -24 ? A HIS 6 7 1 Y 1 A HIS -23 ? A HIS 7 8 1 Y 1 A HIS -22 ? A HIS 8 9 1 Y 1 A HIS -21 ? A HIS 9 10 1 Y 1 A HIS -20 ? A HIS 10 11 1 Y 1 A SER -19 ? A SER 11 12 1 Y 1 A SER -18 ? A SER 12 13 1 Y 1 A GLY -17 ? A GLY 13 14 1 Y 1 A LEU -16 ? A LEU 14 15 1 Y 1 A VAL -15 ? A VAL 15 16 1 Y 1 A PRO -14 ? A PRO 16 17 1 Y 1 A ARG -13 ? A ARG 17 18 1 Y 1 A GLY -12 ? A GLY 18 19 1 Y 1 A SER -11 ? A SER 19 20 1 Y 1 A GLN -10 ? A GLN 20 21 1 Y 1 A SER -9 ? A SER 21 22 1 Y 1 A THR -8 ? A THR 22 23 1 Y 1 A SER -7 ? A SER 23 24 1 Y 1 A LEU -6 ? A LEU 24 25 1 Y 1 A TYR -5 ? A TYR 25 26 1 Y 1 A LYS -4 ? A LYS 26 27 1 Y 1 A LYS -3 ? A LYS 27 28 1 Y 1 A ALA -2 ? A ALA 28 29 1 Y 1 A GLY -1 ? A GLY 29 30 1 Y 1 A ASP 227 ? A ASP 257 31 1 Y 1 A GLU 228 ? A GLU 258 32 1 Y 1 A ASN 229 ? A ASN 259 33 1 Y 1 A GLU 230 ? A GLU 260 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH #