data_1XQ8 # _entry.id 1XQ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XQ8 pdb_00001xq8 10.2210/pdb1xq8/pdb RCSB RCSB030638 ? ? WWPDB D_1000030638 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XQ8 _pdbx_database_status.recvd_initial_deposition_date 2004-10-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ulmer, T.S.' 1 'Bax, A.' 2 'Cole, N.B.' 3 'Nussbaum, R.L.' 4 # _citation.id primary _citation.title 'Structure and dynamics of micelle-bound human alpha-synuclein' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 9595 _citation.page_last 9603 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15615727 _citation.pdbx_database_id_DOI 10.1074/jbc.M411805200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ulmer, T.S.' 1 ? primary 'Bax, A.' 2 ? primary 'Cole, N.B.' 3 ? primary 'Nussbaum, R.L.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Alpha-synuclein _entity.formula_weight 14476.108 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Non-A beta component of AD amyloid, Non-A4 component of amyloid, NACP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; _entity_poly.pdbx_seq_one_letter_code_can ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 VAL n 1 4 PHE n 1 5 MET n 1 6 LYS n 1 7 GLY n 1 8 LEU n 1 9 SER n 1 10 LYS n 1 11 ALA n 1 12 LYS n 1 13 GLU n 1 14 GLY n 1 15 VAL n 1 16 VAL n 1 17 ALA n 1 18 ALA n 1 19 ALA n 1 20 GLU n 1 21 LYS n 1 22 THR n 1 23 LYS n 1 24 GLN n 1 25 GLY n 1 26 VAL n 1 27 ALA n 1 28 GLU n 1 29 ALA n 1 30 ALA n 1 31 GLY n 1 32 LYS n 1 33 THR n 1 34 LYS n 1 35 GLU n 1 36 GLY n 1 37 VAL n 1 38 LEU n 1 39 TYR n 1 40 VAL n 1 41 GLY n 1 42 SER n 1 43 LYS n 1 44 THR n 1 45 LYS n 1 46 GLU n 1 47 GLY n 1 48 VAL n 1 49 VAL n 1 50 HIS n 1 51 GLY n 1 52 VAL n 1 53 ALA n 1 54 THR n 1 55 VAL n 1 56 ALA n 1 57 GLU n 1 58 LYS n 1 59 THR n 1 60 LYS n 1 61 GLU n 1 62 GLN n 1 63 VAL n 1 64 THR n 1 65 ASN n 1 66 VAL n 1 67 GLY n 1 68 GLY n 1 69 ALA n 1 70 VAL n 1 71 VAL n 1 72 THR n 1 73 GLY n 1 74 VAL n 1 75 THR n 1 76 ALA n 1 77 VAL n 1 78 ALA n 1 79 GLN n 1 80 LYS n 1 81 THR n 1 82 VAL n 1 83 GLU n 1 84 GLY n 1 85 ALA n 1 86 GLY n 1 87 SER n 1 88 ILE n 1 89 ALA n 1 90 ALA n 1 91 ALA n 1 92 THR n 1 93 GLY n 1 94 PHE n 1 95 VAL n 1 96 LYS n 1 97 LYS n 1 98 ASP n 1 99 GLN n 1 100 LEU n 1 101 GLY n 1 102 LYS n 1 103 ASN n 1 104 GLU n 1 105 GLU n 1 106 GLY n 1 107 ALA n 1 108 PRO n 1 109 GLN n 1 110 GLU n 1 111 GLY n 1 112 ILE n 1 113 LEU n 1 114 GLU n 1 115 ASP n 1 116 MET n 1 117 PRO n 1 118 VAL n 1 119 ASP n 1 120 PRO n 1 121 ASP n 1 122 ASN n 1 123 GLU n 1 124 ALA n 1 125 TYR n 1 126 GLU n 1 127 MET n 1 128 PRO n 1 129 SER n 1 130 GLU n 1 131 GLU n 1 132 GLY n 1 133 TYR n 1 134 GLN n 1 135 ASP n 1 136 TYR n 1 137 GLU n 1 138 PRO n 1 139 GLU n 1 140 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'SNCA, NACP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-41 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SYUA_HUMAN _struct_ref.pdbx_db_accession P37840 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XQ8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P37840 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 140 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HNCO-QJ 1 2 1 'HN(CO)CA-QJ' 1 3 1 HNCO-JNH 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.2 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 115 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 MM ALPHA-SYNUCLEIN 2H, 13C, 15N' _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 600 ? 2 DRX Bruker 800 ? # _pdbx_nmr_refine.entry_id 1XQ8 _pdbx_nmr_refine.method 'MOLECULAR FRAGMENT REPLACEMENT, SIMULATED ANNEALING' _pdbx_nmr_refine.details ;PLEASE NOTE THAT LARGE AMPLITUDE DYNAMICS ARE PRESENT IN THIS SYSTEM, DESCRIBED IN THE PRIMARY CITATION, AND THE REPORTED STRUCTURE MERELY REPRESENTS THE EFFECTIVE AVERAGE CONFORMATION OF THE MOLECULE. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1XQ8 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'AVERAGE STRUCTURE' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1XQ8 _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 2.9.5 BRUNGER 1 'structure solution' X-PLOR 2.9.5 ? 2 # _exptl.entry_id 1XQ8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1XQ8 _struct.title 'Human micelle-bound alpha-synuclein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1XQ8 _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'micelle-bound helix, LIPID BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 3 ? VAL A 37 ? VAL A 3 VAL A 37 1 ? 35 HELX_P HELX_P2 2 LYS A 45 ? THR A 92 ? LYS A 45 THR A 92 1 ? 48 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1XQ8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XQ8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 MET 127 127 127 MET MET A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ALA 140 140 140 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-11 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX THE SECONDARY STRUCTURE OF THIS PROTEIN WAS AUTHOR DETERMINED ; # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 122 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ALA _pdbx_validate_close_contact.auth_seq_id_2 124 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 95 ? ? -52.18 101.52 2 1 LYS A 96 ? ? -46.73 163.31 3 1 GLN A 99 ? ? -175.72 -30.10 4 1 LYS A 102 ? ? 48.10 90.03 5 1 GLU A 105 ? ? 168.47 120.48 6 1 GLN A 109 ? ? -57.01 -109.53 7 1 GLU A 110 ? ? -171.13 -17.46 8 1 GLU A 114 ? ? -54.43 -3.87 9 1 ASN A 122 ? ? -170.31 30.68 10 1 GLU A 123 ? ? 66.99 -52.52 11 1 ALA A 124 ? ? -156.57 -139.70 12 1 TYR A 125 ? ? -53.41 -72.31 13 1 GLU A 126 ? ? -151.08 88.83 14 1 MET A 127 ? ? 52.67 -171.21 15 1 GLU A 130 ? ? 35.41 -149.52 16 1 TYR A 133 ? ? 56.83 -77.99 17 1 ASP A 135 ? ? -163.33 -17.92 #