data_1XS8 # _entry.id 1XS8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XS8 pdb_00001xs8 10.2210/pdb1xs8/pdb RCSB RCSB030707 ? ? WWPDB D_1000030707 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XS8 _pdbx_database_status.recvd_initial_deposition_date 2004-10-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qiu, C.' 1 'Thorgersen, M.P.' 2 'Westler, W.M.' 3 'Downs, D.M.' 4 'Markley, J.L.' 5 # _citation.id primary _citation.title 'Solution strutcure of Yggx:a protein involved in protection of Fe-S clusters towards oxidation' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qiu, C.' 1 ? primary 'Thorgersen, M.P.' 2 ? primary 'Westler, W.M.' 3 ? primary 'Downs, D.M.' 4 ? primary 'Markley, J.L.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UPF0269 protein yggX' _entity.formula_weight 10915.433 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQTMLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDV HIEGYTPEDKK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQTMLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDV HIEGYTPEDKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ARG n 1 4 THR n 1 5 ILE n 1 6 PHE n 1 7 CYS n 1 8 THR n 1 9 TYR n 1 10 LEU n 1 11 GLN n 1 12 ARG n 1 13 ASP n 1 14 ALA n 1 15 GLU n 1 16 GLY n 1 17 GLN n 1 18 ASP n 1 19 PHE n 1 20 GLN n 1 21 LEU n 1 22 TYR n 1 23 PRO n 1 24 GLY n 1 25 GLU n 1 26 LEU n 1 27 GLY n 1 28 LYS n 1 29 ARG n 1 30 ILE n 1 31 TYR n 1 32 ASN n 1 33 GLU n 1 34 ILE n 1 35 SER n 1 36 LYS n 1 37 ASP n 1 38 ALA n 1 39 TRP n 1 40 ALA n 1 41 GLN n 1 42 TRP n 1 43 GLN n 1 44 HIS n 1 45 LYS n 1 46 GLN n 1 47 THR n 1 48 MET n 1 49 LEU n 1 50 ILE n 1 51 ASN n 1 52 GLU n 1 53 LYS n 1 54 LYS n 1 55 LEU n 1 56 ASN n 1 57 MET n 1 58 MET n 1 59 ASN n 1 60 ALA n 1 61 GLU n 1 62 HIS n 1 63 ARG n 1 64 LYS n 1 65 LEU n 1 66 LEU n 1 67 GLU n 1 68 GLN n 1 69 GLU n 1 70 MET n 1 71 VAL n 1 72 SER n 1 73 PHE n 1 74 LEU n 1 75 PHE n 1 76 GLU n 1 77 GLY n 1 78 LYS n 1 79 ASP n 1 80 VAL n 1 81 HIS n 1 82 ILE n 1 83 GLU n 1 84 GLY n 1 85 TYR n 1 86 THR n 1 87 PRO n 1 88 GLU n 1 89 ASP n 1 90 LYS n 1 91 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Salmonella _entity_src_gen.pdbx_gene_src_gene yggX _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Typhimurium LT2' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella typhimurium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 602 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTYB2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FETP_SALTY _struct_ref.pdbx_db_accession P67617 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQTMLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVH IEGYTPEDKK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XS8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P67617 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 90 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 91 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1XS8 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P67617 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 283 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '19.3 mg/mL YggX, 10 mM deuterated Tris, 10% D2O/H2O' _pdbx_nmr_sample_details.solvent_system '10% D2O/H2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 800 2 ? Varian INOVA 600 # _pdbx_nmr_refine.entry_id 1XS8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;the structures are based on a total of 2568 restraints, 2410 are NOE-derived distance constraints, 106 dihedral angle restraints,52 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1XS8 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1XS8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1XS8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1 collection Varian 1 NMRPipe 1.7 processing 'Frank Delaglio' 2 Felix 98 'data analysis' Accelrys 3 CNS 1.1 'structure solution' Brunger,Adams,Clore,Nilges. 4 ARIA 1.2 refinement Nilges 5 # _exptl.entry_id 1XS8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1XS8 _struct.title 'Solution Structure of YGGX protein of salmonella enterica' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XS8 _struct_keywords.pdbx_keywords 'METAL TRANSPORT' _struct_keywords.text 'helix-turn-helix, METAL TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 24 ? ASN A 32 ? GLY A 24 ASN A 32 1 ? 9 HELX_P HELX_P2 2 SER A 35 ? LYS A 54 ? SER A 35 LYS A 54 1 ? 20 HELX_P HELX_P3 3 ASN A 59 ? PHE A 75 ? ASN A 59 PHE A 75 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 4 ? PHE A 6 ? THR A 4 PHE A 6 A 2 ASP A 13 ? GLU A 15 ? ASP A 13 GLU A 15 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 5 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 5 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ALA _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 14 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 14 # _database_PDB_matrix.entry_id 1XS8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XS8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 MET 70 70 70 MET MET A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-04 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 18 ? ? -71.66 -87.57 2 1 TYR A 22 ? ? -176.00 -49.57 3 1 GLU A 76 ? ? 72.85 -56.55 4 2 PHE A 19 ? ? -174.42 -73.70 5 2 GLN A 20 ? ? 62.11 84.57 6 2 LEU A 21 ? ? -93.69 -74.71 7 2 TYR A 85 ? ? 61.84 -162.53 8 3 GLN A 17 ? ? -65.61 -88.36 9 3 TYR A 22 ? ? -162.85 -53.15 10 3 GLU A 76 ? ? 72.28 -48.04 11 3 GLU A 83 ? ? -140.72 -52.43 12 3 PRO A 87 ? ? -69.29 99.27 13 4 GLN A 17 ? ? 57.87 -152.75 14 4 ASP A 18 ? ? -113.10 -167.90 15 4 GLN A 20 ? ? -61.41 96.34 16 4 TYR A 22 ? ? -174.04 -53.70 17 4 GLU A 76 ? ? 62.49 92.37 18 4 TYR A 85 ? ? 60.03 -171.83 19 5 PHE A 19 ? ? 70.19 115.83 20 5 TYR A 22 ? ? -160.88 -49.00 21 6 TYR A 22 ? ? -148.79 -56.59 22 6 GLU A 76 ? ? 68.73 90.13 23 6 ASP A 89 ? ? 73.11 -69.17 24 7 GLN A 17 ? ? 61.40 -174.18 25 7 TYR A 22 ? ? -151.52 -57.30 26 7 LYS A 54 ? ? 54.49 70.06 27 7 PRO A 87 ? ? -66.86 99.72 28 7 GLU A 88 ? ? -104.42 -71.78 29 8 SER A 2 ? ? -90.91 -146.89 30 8 GLN A 17 ? ? -60.84 -93.11 31 8 GLN A 20 ? ? -67.89 99.27 32 8 TYR A 22 ? ? -169.28 -51.65 33 8 GLU A 76 ? ? 73.11 -28.48 34 8 GLU A 83 ? ? -140.08 -39.02 35 8 TYR A 85 ? ? 56.30 91.77 36 9 SER A 2 ? ? 59.89 -157.16 37 9 GLN A 17 ? ? -70.24 -167.89 38 9 ASP A 18 ? ? -76.57 -168.78 39 9 TYR A 22 ? ? -154.51 -53.08 40 9 MET A 57 ? ? -92.63 41.49 41 9 GLU A 83 ? ? 62.34 92.08 42 9 PRO A 87 ? ? -73.60 -169.89 43 10 GLN A 17 ? ? -75.49 -111.16 44 10 TYR A 22 ? ? -153.42 -53.63 45 10 LYS A 54 ? ? 61.14 80.89 46 10 GLU A 83 ? ? -144.58 -31.49 47 10 PRO A 87 ? ? -68.99 -178.18 48 10 GLU A 88 ? ? 62.51 77.80 49 11 GLN A 17 ? ? 58.33 -166.12 50 11 ASP A 18 ? ? -91.27 -153.62 51 11 TYR A 22 ? ? -156.99 -50.83 52 11 LYS A 54 ? ? 53.55 79.58 53 11 SER A 72 ? ? -90.51 -63.89 54 11 GLU A 83 ? ? -154.60 -61.66 55 12 GLN A 17 ? ? 47.14 -111.05 56 12 TYR A 22 ? ? -160.93 -55.45 57 12 GLU A 76 ? ? 58.06 75.15 58 12 LYS A 90 ? ? -154.25 14.95 59 13 TYR A 22 ? ? -159.06 -53.05 60 13 LYS A 54 ? ? 57.82 73.44 61 13 GLU A 76 ? ? 65.05 101.09 62 13 GLU A 83 ? ? -150.80 -39.97 63 13 ASP A 89 ? ? 65.04 87.45 64 14 ASP A 18 ? ? -73.71 -94.29 65 14 TYR A 22 ? ? -168.28 -54.54 66 14 LYS A 54 ? ? 51.33 77.39 67 14 GLU A 83 ? ? -166.57 -51.95 68 14 TYR A 85 ? ? 58.14 -159.25 69 14 GLU A 88 ? ? -114.71 -75.06 70 15 SER A 2 ? ? 66.12 -177.54 71 15 GLN A 17 ? ? 43.75 -151.94 72 15 LEU A 21 ? ? -101.84 -69.62 73 15 TYR A 22 ? ? -140.71 -44.43 74 15 GLU A 83 ? ? -157.66 33.34 75 15 ASP A 89 ? ? -99.31 -64.65 76 16 ASP A 18 ? ? -177.18 -163.60 77 16 TYR A 22 ? ? -133.83 -49.63 78 16 LYS A 54 ? ? 60.99 67.38 79 16 GLU A 76 ? ? 53.03 77.60 80 17 ASP A 18 ? ? -170.29 -163.38 81 17 PHE A 19 ? ? -118.13 -163.27 82 17 TYR A 22 ? ? -146.52 -48.85 83 17 MET A 57 ? ? -75.90 40.43 84 17 GLU A 76 ? ? 61.89 97.51 85 17 GLU A 83 ? ? 64.19 84.00 86 17 PRO A 87 ? ? -84.17 -73.96 87 18 SER A 2 ? ? 65.30 95.79 88 18 GLN A 17 ? ? -76.09 -161.38 89 18 ASP A 18 ? ? -73.78 -168.62 90 18 PHE A 19 ? ? -100.37 -92.16 91 18 LEU A 21 ? ? -104.02 -73.32 92 18 GLU A 76 ? ? 60.74 90.31 93 18 GLU A 83 ? ? 58.18 18.38 94 18 LYS A 90 ? ? -69.77 99.19 95 19 LEU A 21 ? ? -111.85 -84.61 96 19 LYS A 54 ? ? 57.50 78.76 97 19 GLU A 76 ? ? 70.67 -75.56 98 19 ASP A 89 ? ? -51.90 -70.49 99 20 ASP A 18 ? ? -162.34 -158.40 100 20 TYR A 22 ? ? -149.37 -33.74 101 20 GLU A 76 ? ? 72.79 -55.89 #