data_1XT3 # _entry.id 1XT3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1XT3 RCSB RCSB030736 WWPDB D_1000030736 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XT3 _pdbx_database_status.recvd_initial_deposition_date 2004-10-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, S.-C.' 1 'Guan, H.-H.' 2 'Wang, C.-H.' 3 'Huang, W.-N.' 4 'Chen, C.-J.' 5 'Wu, W.-G.' 6 # _citation.id primary _citation.title 'Structural basis of citrate-dependent and heparan sulfate-mediated cell surface retention of cobra cardiotoxin A3' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 9567 _citation.page_last 9577 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15590643 _citation.pdbx_database_id_DOI 10.1074/jbc.M412398200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, S.-C.' 1 ? primary 'Guan, H.-H.' 2 ? primary 'Wang, C.-H.' 3 ? primary 'Huang, W.-N.' 4 ? primary 'Tjong, S.-C.' 5 ? primary 'Chen, C.-J.' 6 ? primary 'Wu, W.-G.' 7 ? # _cell.entry_id 1XT3 _cell.length_a 43.903 _cell.length_b 59.447 _cell.length_c 98.620 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1XT3 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Cytotoxin 3' 6758.330 2 ? ? ? ? 2 branched man ;2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose-(1-4)-2-O-sulfo-alpha-L-idopyranuronic acid-(1-4)-2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose ; 1750.427 1 ? ? ? ? 3 non-polymer syn 'CITRIC ACID' 192.124 1 ? ? ? ? 4 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cardiotoxin 3, CTX-3, Cardiotoxin analog III, CTX III' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN _entity_poly.pdbx_seq_one_letter_code_can LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 LYS n 1 3 CYS n 1 4 ASN n 1 5 LYS n 1 6 LEU n 1 7 VAL n 1 8 PRO n 1 9 LEU n 1 10 PHE n 1 11 TYR n 1 12 LYS n 1 13 THR n 1 14 CYS n 1 15 PRO n 1 16 ALA n 1 17 GLY n 1 18 LYS n 1 19 ASN n 1 20 LEU n 1 21 CYS n 1 22 TYR n 1 23 LYS n 1 24 MET n 1 25 PHE n 1 26 MET n 1 27 VAL n 1 28 ALA n 1 29 THR n 1 30 PRO n 1 31 LYS n 1 32 VAL n 1 33 PRO n 1 34 VAL n 1 35 LYS n 1 36 ARG n 1 37 GLY n 1 38 CYS n 1 39 ILE n 1 40 ASP n 1 41 VAL n 1 42 CYS n 1 43 PRO n 1 44 LYS n 1 45 SER n 1 46 SER n 1 47 LEU n 1 48 LEU n 1 49 VAL n 1 50 LYS n 1 51 TYR n 1 52 VAL n 1 53 CYS n 1 54 CYS n 1 55 ASN n 1 56 THR n 1 57 ASP n 1 58 ARG n 1 59 CYS n 1 60 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Chinese cobra' _entity_src_nat.pdbx_organism_scientific 'Naja atra' _entity_src_nat.pdbx_ncbi_taxonomy_id 8656 _entity_src_nat.genus Naja _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CTX3_NAJAT _struct_ref.pdbx_db_accession P60301 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1XT3 A 1 ? 60 ? P60301 22 ? 81 ? 1 60 2 1 1XT3 B 1 ? 60 ? P60301 22 ? 81 ? 1 60 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 IDS 'L-saccharide, alpha linking' n '2-O-sulfo-alpha-L-idopyranuronic acid' 'O2-SULFO-GLUCURONIC ACID' 'C6 H10 O10 S' 274.203 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SGN 'D-saccharide, alpha linking' n '2-deoxy-6-O-sulfo-2-(sulfoamino)-alpha-D-glucopyranose' ? 'C6 H13 N O11 S2' 339.298 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1XT3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.893 _exptl_crystal.density_percent_sol 35.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pdbx_details 'PEG4000, isopropanol, trisodium citrate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2004-07-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1274 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSRRC BEAMLINE BL17B2' _diffrn_source.pdbx_synchrotron_site NSRRC _diffrn_source.pdbx_synchrotron_beamline BL17B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.1274 # _reflns.entry_id 1XT3 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.4 _reflns.d_resolution_low 25 _reflns.number_all 5051 _reflns.number_obs 4889 _reflns.percent_possible_obs 96.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.038 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.4 _reflns_shell.d_res_low 2.48 _reflns_shell.percent_possible_all 83.6 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1XT3 _refine.ls_d_res_high 2.4 _refine.ls_d_res_low 25 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 5051 _refine.ls_number_reflns_obs 4889 _refine.ls_number_reflns_R_free 245 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all 0.242 _refine.ls_R_factor_obs 0.231 _refine.ls_R_factor_R_work 0.227 _refine.ls_R_factor_R_free 0.25 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 930 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 118 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 1058 _refine_hist.d_res_high 2.4 _refine_hist.d_res_low 25 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.005 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.170 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1XT3 _struct.title 'Structure Basis of Venom Citrate-Dependent Heparin Sulfate-Mediated Cell Surface Retention of Cobra Cardiotoxin A3' _struct.pdbx_descriptor 'Cytotoxin 3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XT3 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'CTX-3, heparin, citrate, Toxin' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 3 A CYS 21 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 14 A CYS 38 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf3 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 42 A CYS 53 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf4 disulf ? ? A CYS 54 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 54 A CYS 59 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf5 disulf ? ? B CYS 3 SG ? ? ? 1_555 B CYS 14 SG ? ? B CYS 3 B CYS 14 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf6 disulf ? ? B CYS 3 SG ? ? ? 1_555 B CYS 21 SG ? ? B CYS 3 B CYS 21 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf7 disulf ? ? B CYS 14 SG ? ? ? 1_555 B CYS 38 SG ? ? B CYS 14 B CYS 38 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf8 disulf ? ? B CYS 42 SG ? ? ? 1_555 B CYS 53 SG ? ? B CYS 42 B CYS 53 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf9 disulf ? ? B CYS 54 SG ? ? ? 1_555 B CYS 59 SG ? ? B CYS 54 B CYS 59 1_555 ? ? ? ? ? ? ? 2.029 ? ? covale1 covale both ? C SGN . O4 ? ? ? 1_555 C IDS . C1 ? ? C SGN 1 C IDS 2 1_555 ? ? ? ? ? ? ? 1.420 ? ? covale2 covale both ? C IDS . O4 ? ? ? 1_555 C SGN . C1 ? ? C IDS 2 C SGN 3 1_555 ? ? ? ? ? ? ? 1.428 ? ? covale3 covale both ? C SGN . O4 ? ? ? 1_555 C IDS . C1 ? ? C SGN 3 C IDS 4 1_555 ? ? ? ? ? ? ? 1.461 ? ? covale4 covale both ? C IDS . O4 ? ? ? 1_555 C SGN . C1 ? ? C IDS 4 C SGN 5 1_555 ? ? ? ? ? ? ? 1.433 ? ? covale5 covale both ? C SGN . O4 ? ? ? 1_555 C IDS . C1 ? ? C SGN 5 C IDS 6 1_555 ? ? ? ? ? ? ? 1.442 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 2 ? ASN A 4 ? LYS A 2 ASN A 4 A 2 TYR A 11 ? THR A 13 ? TYR A 11 THR A 13 B 1 LYS A 35 ? CYS A 38 ? LYS A 35 CYS A 38 B 2 CYS A 21 ? MET A 26 ? CYS A 21 MET A 26 B 3 VAL A 49 ? CYS A 54 ? VAL A 49 CYS A 54 C 1 LYS B 35 ? CYS B 38 ? LYS B 35 CYS B 38 C 2 CYS B 21 ? MET B 26 ? CYS B 21 MET B 26 C 3 VAL B 49 ? CYS B 54 ? VAL B 49 CYS B 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 3 ? N CYS A 3 O LYS A 12 ? O LYS A 12 B 1 2 O GLY A 37 ? O GLY A 37 N TYR A 22 ? N TYR A 22 B 2 3 N LYS A 23 ? N LYS A 23 O VAL A 52 ? O VAL A 52 C 1 2 O LYS B 35 ? O LYS B 35 N MET B 24 ? N MET B 24 C 2 3 N CYS B 21 ? N CYS B 21 O CYS B 54 ? O CYS B 54 # _database_PDB_matrix.entry_id 1XT3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XT3 _atom_sites.fract_transf_matrix[1][1] 0.022777 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016822 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010140 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _database_PDB_caveat.text 'IDS C 6 HAS WRONG CHIRALITY AT ATOM C5' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n B 1 1 LEU 1 1 1 LEU LEU B . n B 1 2 LYS 2 2 2 LYS LYS B . n B 1 3 CYS 3 3 3 CYS CYS B . n B 1 4 ASN 4 4 4 ASN ASN B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 PRO 8 8 8 PRO PRO B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 TYR 11 11 11 TYR TYR B . n B 1 12 LYS 12 12 12 LYS LYS B . n B 1 13 THR 13 13 13 THR THR B . n B 1 14 CYS 14 14 14 CYS CYS B . n B 1 15 PRO 15 15 15 PRO PRO B . n B 1 16 ALA 16 16 16 ALA ALA B . n B 1 17 GLY 17 17 17 GLY GLY B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 ASN 19 19 19 ASN ASN B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 CYS 21 21 21 CYS CYS B . n B 1 22 TYR 22 22 22 TYR TYR B . n B 1 23 LYS 23 23 23 LYS LYS B . n B 1 24 MET 24 24 24 MET MET B . n B 1 25 PHE 25 25 25 PHE PHE B . n B 1 26 MET 26 26 26 MET MET B . n B 1 27 VAL 27 27 27 VAL VAL B . n B 1 28 ALA 28 28 28 ALA ALA B . n B 1 29 THR 29 29 29 THR THR B . n B 1 30 PRO 30 30 30 PRO PRO B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 PRO 33 33 33 PRO PRO B . n B 1 34 VAL 34 34 34 VAL VAL B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 GLY 37 37 37 GLY GLY B . n B 1 38 CYS 38 38 38 CYS CYS B . n B 1 39 ILE 39 39 39 ILE ILE B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 CYS 42 42 42 CYS CYS B . n B 1 43 PRO 43 43 43 PRO PRO B . n B 1 44 LYS 44 44 44 LYS LYS B . n B 1 45 SER 45 45 45 SER SER B . n B 1 46 SER 46 46 46 SER SER B . n B 1 47 LEU 47 47 47 LEU LEU B . n B 1 48 LEU 48 48 48 LEU LEU B . n B 1 49 VAL 49 49 49 VAL VAL B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 TYR 51 51 51 TYR TYR B . n B 1 52 VAL 52 52 52 VAL VAL B . n B 1 53 CYS 53 53 53 CYS CYS B . n B 1 54 CYS 54 54 54 CYS CYS B . n B 1 55 ASN 55 55 55 ASN ASN B . n B 1 56 THR 56 56 56 THR THR B . n B 1 57 ASP 57 57 57 ASP ASP B . n B 1 58 ARG 58 58 58 ARG ARG B . n B 1 59 CYS 59 59 59 CYS CYS B . n B 1 60 ASN 60 60 60 ASN ASN B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 CIT 1 101 101 CIT CIT A . E 4 HOH 1 102 102 HOH HOH A . E 4 HOH 2 103 103 HOH HOH A . E 4 HOH 3 104 104 HOH HOH A . E 4 HOH 4 105 105 HOH HOH A . E 4 HOH 5 106 106 HOH HOH A . E 4 HOH 6 107 107 HOH HOH A . E 4 HOH 7 108 108 HOH HOH A . E 4 HOH 8 109 109 HOH HOH A . E 4 HOH 9 110 110 HOH HOH A . F 4 HOH 1 61 61 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D,E 1 2 B,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2780 ? 1 MORE -1 ? 1 'SSA (A^2)' 8100 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 -x+1/2,y+1/2,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 21.9515000000 0.0000000000 1.0000000000 0.0000000000 29.7235000000 0.0000000000 0.0000000000 -1.0000000000 49.3100000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-12-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 5 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' Advisory 6 5 'Structure model' 'Atomic model' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' atom_site 3 5 'Structure model' chem_comp 4 5 'Structure model' database_PDB_caveat 5 5 'Structure model' entity 6 5 'Structure model' pdbx_branch_scheme 7 5 'Structure model' pdbx_chem_comp_identifier 8 5 'Structure model' pdbx_entity_branch 9 5 'Structure model' pdbx_entity_branch_descriptor 10 5 'Structure model' pdbx_entity_branch_link 11 5 'Structure model' pdbx_entity_branch_list 12 5 'Structure model' pdbx_entity_nonpoly 13 5 'Structure model' pdbx_nonpoly_scheme 14 5 'Structure model' pdbx_struct_assembly_gen 15 5 'Structure model' pdbx_unobs_or_zero_occ_atoms 16 5 'Structure model' pdbx_validate_chiral 17 5 'Structure model' struct_asym 18 5 'Structure model' struct_conn 19 5 'Structure model' struct_site 20 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.name' 3 5 'Structure model' '_atom_site.B_iso_or_equiv' 4 5 'Structure model' '_atom_site.Cartn_x' 5 5 'Structure model' '_atom_site.Cartn_y' 6 5 'Structure model' '_atom_site.Cartn_z' 7 5 'Structure model' '_atom_site.auth_asym_id' 8 5 'Structure model' '_atom_site.auth_atom_id' 9 5 'Structure model' '_atom_site.auth_comp_id' 10 5 'Structure model' '_atom_site.auth_seq_id' 11 5 'Structure model' '_atom_site.label_asym_id' 12 5 'Structure model' '_atom_site.label_atom_id' 13 5 'Structure model' '_atom_site.label_comp_id' 14 5 'Structure model' '_atom_site.label_entity_id' 15 5 'Structure model' '_atom_site.type_symbol' 16 5 'Structure model' '_chem_comp.mon_nstd_flag' 17 5 'Structure model' '_chem_comp.name' 18 5 'Structure model' '_chem_comp.type' 19 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 20 5 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.auth_asym_id' 21 5 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.auth_seq_id' 22 5 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_seq_id' 23 5 'Structure model' '_pdbx_validate_chiral.auth_asym_id' 24 5 'Structure model' '_pdbx_validate_chiral.auth_seq_id' 25 5 'Structure model' '_struct_conn.pdbx_dist_value' 26 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 27 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 28 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 29 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 30 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 31 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 32 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 33 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 34 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 35 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 36 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 37 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 38 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 39 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal XDS 'data scaling' . ? 1 SCALEPACK 'data scaling' . ? 2 CNS refinement . ? 3 XDS 'data reduction' . ? 4 CNS phasing . ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 CIT _pdbx_validate_symm_contact.auth_seq_id_1 101 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 CIT _pdbx_validate_symm_contact.auth_seq_id_2 101 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_555 _pdbx_validate_symm_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 9 ? ? -60.89 2.30 2 1 ALA A 16 ? ? -31.28 135.49 3 1 LYS A 18 ? ? -52.28 92.70 4 1 ASN A 19 ? ? -105.25 49.61 5 1 SER A 46 ? ? -93.65 -134.16 6 1 LEU A 47 ? ? -98.26 -62.58 7 1 THR B 13 ? ? -50.01 103.49 8 1 PRO B 15 ? ? -59.33 -179.01 9 1 VAL B 27 ? ? -20.26 -43.15 10 1 THR B 29 ? ? -150.31 73.82 11 1 VAL B 32 ? ? -102.68 64.26 12 1 ASP B 40 ? ? -61.42 -90.97 13 1 SER B 45 ? ? -80.87 -159.55 14 1 SER B 46 ? ? -148.17 -157.71 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C5 _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id C _pdbx_validate_chiral.auth_comp_id IDS _pdbx_validate_chiral.auth_seq_id 6 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id C _pdbx_unobs_or_zero_occ_atoms.auth_comp_id IDS _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 6 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O4 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id C _pdbx_unobs_or_zero_occ_atoms.label_comp_id IDS _pdbx_unobs_or_zero_occ_atoms.label_seq_id 6 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O4 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero C 2 SGN 1 C SGN 1 A SGN 66 n C 2 IDS 2 C IDS 2 A IDS 65 n C 2 SGN 3 C SGN 3 A SGN 64 n C 2 IDS 4 C IDS 4 A IDS 63 n C 2 SGN 5 C SGN 5 A SGN 62 n C 2 IDS 6 C IDS 6 A IDS 61 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier IDS 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-IdopA2SO3 SGN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 'DGlcpNS[6S]a' SGN 'COMMON NAME' GMML 1.0 N-sulfo-6-sulfo-a-D-glucopyranose SGN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-GlcpNSO36SO3 # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'WURCS=2.0/2,6,5/[a2122h-1a_1-5_2*NSO/3=O/3=O_6*OSO/3=O/3=O][a2121A-1a_1-5_2*OSO/3=O/3=O]/1-2-1-2-1-2/a4-b1_b4-c1_c4-d1_d4-e1_e4-f1' WURCS PDB2Glycan 1.1.0 2 2 ;[][a-D-GlcpNSO36SO3]{[(4+1)][a-L-IdopA2SO3]{[(4+1)][a-D-GlcpNSO36SO3]{[(4+1)][a-L-IdopA2SO3]{[(4+1)][a-D-GlcpNSO36SO3]{[(4+1)][a-L-4-deoxy-IdopA2SO3]{}}}}}} ; LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 IDS C1 O1 1 SGN O4 HO4 sing ? 2 2 3 SGN C1 O1 2 IDS O4 HO4 sing ? 3 2 4 IDS C1 O1 3 SGN O4 HO4 sing ? 4 2 5 SGN C1 O1 4 IDS O4 HO4 sing ? 5 2 6 IDS C1 O1 5 SGN O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 SGN 1 n 2 IDS 2 n 2 SGN 3 n 2 IDS 4 n 2 SGN 5 n 2 IDS 6 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CITRIC ACID' CIT 4 water HOH #