data_1XTO # _entry.id 1XTO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XTO pdb_00001xto 10.2210/pdb1xto/pdb RCSB RCSB030756 ? ? WWPDB D_1000030756 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-09 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 5 'Structure model' 1 4 2024-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Version format compliance' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' chem_comp_atom 3 5 'Structure model' chem_comp_bond 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_database_related 6 5 'Structure model' pdbx_struct_conn_angle 7 5 'Structure model' struct_conn 8 5 'Structure model' struct_ref_seq_dif 9 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.name' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_database_related.db_name' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.value' 10 5 'Structure model' '_struct_conn.pdbx_dist_value' 11 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 13 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 14 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 15 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 16 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 17 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 18 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 19 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 20 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 21 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 22 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 23 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 24 5 'Structure model' '_struct_ref_seq_dif.details' 25 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XTO _pdbx_database_status.recvd_initial_deposition_date 2004-10-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id PpR6 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Chen, Y.' 2 'Kuzin, A.' 3 'Vorobiev, S.M.' 4 'Xiao, R.' 5 'Acton, T.B.' 6 'Montelione, G.T.' 7 'Hunt, J.F.' 8 'Tong, L.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title 'Crystal Structure of the Coenzyme PQQ Synthesis Protein (PqqB) from Pseudomonas putida, Northeast Structural Genomics Target PpR6' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Forouhar, F.' 1 ? primary 'Chen, Y.' 2 ? primary 'Kuzin, A.' 3 ? primary 'Vorobiev, S.M.' 4 ? primary 'Xiao, R.' 5 ? primary 'Acton, T.B.' 6 ? primary 'Montelione, G.T.' 7 ? primary 'Hunt, J.F.' 8 ? primary 'Tong, L.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Coenzyme PQQ synthesis protein B' 34952.828 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 33 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Pyrroloquinoline quinone biosynthesis protein B, PqqB' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)YIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAP(MSE)QP ARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTD(MSE)VHQDLTTGFPLFN(MSE)LSHWNGGLQWNRIELEG SFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGL(MSE)VEDTRTGGKLFYAPGLGQVDEKLLA(MSE)(MSE)H GADCLLVDGTLWEDDE(MSE)QRRGVGTRTGRE(MSE)GHLAQNGPGG(MSE)LEVLDGFPRQRKVLIHINNTNPILDEN SPERAEVLRRGVEVAFDG(MSE)SIELLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTG INAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFP LRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGR EMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier PpR6 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 TYR n 1 3 ILE n 1 4 GLN n 1 5 VAL n 1 6 LEU n 1 7 GLY n 1 8 SER n 1 9 ALA n 1 10 ALA n 1 11 GLY n 1 12 GLY n 1 13 GLY n 1 14 PHE n 1 15 PRO n 1 16 GLN n 1 17 TRP n 1 18 ASN n 1 19 CYS n 1 20 ASN n 1 21 CYS n 1 22 VAL n 1 23 ASN n 1 24 CYS n 1 25 LYS n 1 26 GLY n 1 27 TYR n 1 28 ARG n 1 29 ASP n 1 30 GLY n 1 31 THR n 1 32 LEU n 1 33 LYS n 1 34 ALA n 1 35 THR n 1 36 ALA n 1 37 ARG n 1 38 THR n 1 39 GLN n 1 40 SER n 1 41 SER n 1 42 ILE n 1 43 ALA n 1 44 LEU n 1 45 SER n 1 46 ASP n 1 47 ASP n 1 48 GLY n 1 49 VAL n 1 50 HIS n 1 51 TRP n 1 52 ILE n 1 53 LEU n 1 54 CYS n 1 55 ASN n 1 56 ALA n 1 57 SER n 1 58 PRO n 1 59 ASP n 1 60 ILE n 1 61 ARG n 1 62 ALA n 1 63 GLN n 1 64 LEU n 1 65 GLN n 1 66 ALA n 1 67 PHE n 1 68 ALA n 1 69 PRO n 1 70 MSE n 1 71 GLN n 1 72 PRO n 1 73 ALA n 1 74 ARG n 1 75 ALA n 1 76 LEU n 1 77 ARG n 1 78 ASP n 1 79 THR n 1 80 GLY n 1 81 ILE n 1 82 ASN n 1 83 ALA n 1 84 ILE n 1 85 VAL n 1 86 LEU n 1 87 LEU n 1 88 ASP n 1 89 SER n 1 90 GLN n 1 91 ILE n 1 92 ASP n 1 93 HIS n 1 94 THR n 1 95 THR n 1 96 GLY n 1 97 LEU n 1 98 LEU n 1 99 SER n 1 100 LEU n 1 101 ARG n 1 102 GLU n 1 103 GLY n 1 104 CYS n 1 105 PRO n 1 106 HIS n 1 107 GLN n 1 108 VAL n 1 109 TRP n 1 110 CYS n 1 111 THR n 1 112 ASP n 1 113 MSE n 1 114 VAL n 1 115 HIS n 1 116 GLN n 1 117 ASP n 1 118 LEU n 1 119 THR n 1 120 THR n 1 121 GLY n 1 122 PHE n 1 123 PRO n 1 124 LEU n 1 125 PHE n 1 126 ASN n 1 127 MSE n 1 128 LEU n 1 129 SER n 1 130 HIS n 1 131 TRP n 1 132 ASN n 1 133 GLY n 1 134 GLY n 1 135 LEU n 1 136 GLN n 1 137 TRP n 1 138 ASN n 1 139 ARG n 1 140 ILE n 1 141 GLU n 1 142 LEU n 1 143 GLU n 1 144 GLY n 1 145 SER n 1 146 PHE n 1 147 VAL n 1 148 ILE n 1 149 ASP n 1 150 ALA n 1 151 CYS n 1 152 PRO n 1 153 ASN n 1 154 LEU n 1 155 LYS n 1 156 PHE n 1 157 THR n 1 158 PRO n 1 159 PHE n 1 160 PRO n 1 161 LEU n 1 162 ARG n 1 163 SER n 1 164 ALA n 1 165 ALA n 1 166 PRO n 1 167 PRO n 1 168 TYR n 1 169 SER n 1 170 PRO n 1 171 HIS n 1 172 ARG n 1 173 PHE n 1 174 ASP n 1 175 PRO n 1 176 HIS n 1 177 PRO n 1 178 GLY n 1 179 ASP n 1 180 ASN n 1 181 LEU n 1 182 GLY n 1 183 LEU n 1 184 MSE n 1 185 VAL n 1 186 GLU n 1 187 ASP n 1 188 THR n 1 189 ARG n 1 190 THR n 1 191 GLY n 1 192 GLY n 1 193 LYS n 1 194 LEU n 1 195 PHE n 1 196 TYR n 1 197 ALA n 1 198 PRO n 1 199 GLY n 1 200 LEU n 1 201 GLY n 1 202 GLN n 1 203 VAL n 1 204 ASP n 1 205 GLU n 1 206 LYS n 1 207 LEU n 1 208 LEU n 1 209 ALA n 1 210 MSE n 1 211 MSE n 1 212 HIS n 1 213 GLY n 1 214 ALA n 1 215 ASP n 1 216 CYS n 1 217 LEU n 1 218 LEU n 1 219 VAL n 1 220 ASP n 1 221 GLY n 1 222 THR n 1 223 LEU n 1 224 TRP n 1 225 GLU n 1 226 ASP n 1 227 ASP n 1 228 GLU n 1 229 MSE n 1 230 GLN n 1 231 ARG n 1 232 ARG n 1 233 GLY n 1 234 VAL n 1 235 GLY n 1 236 THR n 1 237 ARG n 1 238 THR n 1 239 GLY n 1 240 ARG n 1 241 GLU n 1 242 MSE n 1 243 GLY n 1 244 HIS n 1 245 LEU n 1 246 ALA n 1 247 GLN n 1 248 ASN n 1 249 GLY n 1 250 PRO n 1 251 GLY n 1 252 GLY n 1 253 MSE n 1 254 LEU n 1 255 GLU n 1 256 VAL n 1 257 LEU n 1 258 ASP n 1 259 GLY n 1 260 PHE n 1 261 PRO n 1 262 ARG n 1 263 GLN n 1 264 ARG n 1 265 LYS n 1 266 VAL n 1 267 LEU n 1 268 ILE n 1 269 HIS n 1 270 ILE n 1 271 ASN n 1 272 ASN n 1 273 THR n 1 274 ASN n 1 275 PRO n 1 276 ILE n 1 277 LEU n 1 278 ASP n 1 279 GLU n 1 280 ASN n 1 281 SER n 1 282 PRO n 1 283 GLU n 1 284 ARG n 1 285 ALA n 1 286 GLU n 1 287 VAL n 1 288 LEU n 1 289 ARG n 1 290 ARG n 1 291 GLY n 1 292 VAL n 1 293 GLU n 1 294 VAL n 1 295 ALA n 1 296 PHE n 1 297 ASP n 1 298 GLY n 1 299 MSE n 1 300 SER n 1 301 ILE n 1 302 GLU n 1 303 LEU n 1 304 LEU n 1 305 GLU n 1 306 HIS n 1 307 HIS n 1 308 HIS n 1 309 HIS n 1 310 HIS n 1 311 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene pqqB _entity_src_gen.gene_src_species 'Pseudomonas putida' _entity_src_gen.gene_src_strain KT2440 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas putida' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 160488 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET21 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BL21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 MSE 70 70 70 MSE MSE A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 CYS 104 104 104 CYS CYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 MSE 113 113 113 MSE MSE A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 MSE 127 127 127 MSE MSE A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 TRP 131 131 131 TRP TRP A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 TRP 137 137 137 TRP TRP A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 CYS 151 151 151 CYS CYS A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 PRO 170 170 170 PRO PRO A . n A 1 171 HIS 171 171 171 HIS HIS A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 PRO 177 177 177 PRO PRO A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ASN 180 180 180 ASN ASN A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 MSE 184 184 184 MSE MSE A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 TYR 196 196 196 TYR TYR A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 MSE 210 210 210 MSE MSE A . n A 1 211 MSE 211 211 211 MSE MSE A . n A 1 212 HIS 212 212 212 HIS HIS A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 CYS 216 216 216 CYS CYS A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 TRP 224 224 224 TRP TRP A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 ASP 226 226 226 ASP ASP A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 MSE 229 229 229 MSE MSE A . n A 1 230 GLN 230 230 230 GLN GLN A . n A 1 231 ARG 231 231 231 ARG ARG A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 THR 236 236 236 THR THR A . n A 1 237 ARG 237 237 237 ARG ARG A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 ARG 240 240 240 ARG ARG A . n A 1 241 GLU 241 241 241 GLU GLU A . n A 1 242 MSE 242 242 242 MSE MSE A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 GLN 247 247 247 GLN GLN A . n A 1 248 ASN 248 248 248 ASN ASN A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 MSE 253 253 253 MSE MSE A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 PHE 260 260 260 PHE PHE A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 ARG 262 262 262 ARG ARG A . n A 1 263 GLN 263 263 263 GLN GLN A . n A 1 264 ARG 264 264 264 ARG ARG A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 ILE 268 268 268 ILE ILE A . n A 1 269 HIS 269 269 269 HIS HIS A . n A 1 270 ILE 270 270 270 ILE ILE A . n A 1 271 ASN 271 271 271 ASN ASN A . n A 1 272 ASN 272 272 272 ASN ASN A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 ASN 274 274 274 ASN ASN A . n A 1 275 PRO 275 275 275 PRO PRO A . n A 1 276 ILE 276 276 276 ILE ILE A . n A 1 277 LEU 277 277 277 LEU LEU A . n A 1 278 ASP 278 278 278 ASP ASP A . n A 1 279 GLU 279 279 279 GLU GLU A . n A 1 280 ASN 280 280 280 ASN ASN A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 PRO 282 282 282 PRO PRO A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 ARG 284 284 284 ARG ARG A . n A 1 285 ALA 285 285 285 ALA ALA A . n A 1 286 GLU 286 286 286 GLU GLU A . n A 1 287 VAL 287 287 287 VAL VAL A . n A 1 288 LEU 288 288 288 LEU LEU A . n A 1 289 ARG 289 289 289 ARG ARG A . n A 1 290 ARG 290 290 290 ARG ARG A . n A 1 291 GLY 291 291 291 GLY GLY A . n A 1 292 VAL 292 292 292 VAL VAL A . n A 1 293 GLU 293 293 293 GLU GLU A . n A 1 294 VAL 294 294 294 VAL VAL A . n A 1 295 ALA 295 295 295 ALA ALA A . n A 1 296 PHE 296 296 296 PHE PHE A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 MSE 299 299 299 MSE MSE A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 ILE 301 301 301 ILE ILE A . n A 1 302 GLU 302 302 302 GLU GLU A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 LEU 304 304 304 LEU LEU A . n A 1 305 GLU 305 305 ? ? ? A . n A 1 306 HIS 306 306 ? ? ? A . n A 1 307 HIS 307 307 ? ? ? A . n A 1 308 HIS 308 308 ? ? ? A . n A 1 309 HIS 309 309 ? ? ? A . n A 1 310 HIS 310 310 ? ? ? A . n A 1 311 HIS 311 311 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 312 1 ZN ZN A . C 3 HOH 1 313 1 HOH HOH A . C 3 HOH 2 314 2 HOH HOH A . C 3 HOH 3 315 3 HOH HOH A . C 3 HOH 4 316 4 HOH HOH A . C 3 HOH 5 317 5 HOH HOH A . C 3 HOH 6 318 6 HOH HOH A . C 3 HOH 7 319 7 HOH HOH A . C 3 HOH 8 320 8 HOH HOH A . C 3 HOH 9 321 9 HOH HOH A . C 3 HOH 10 322 10 HOH HOH A . C 3 HOH 11 323 11 HOH HOH A . C 3 HOH 12 324 12 HOH HOH A . C 3 HOH 13 325 13 HOH HOH A . C 3 HOH 14 326 14 HOH HOH A . C 3 HOH 15 327 15 HOH HOH A . C 3 HOH 16 328 16 HOH HOH A . C 3 HOH 17 329 17 HOH HOH A . C 3 HOH 18 330 18 HOH HOH A . C 3 HOH 19 331 19 HOH HOH A . C 3 HOH 20 332 20 HOH HOH A . C 3 HOH 21 333 21 HOH HOH A . C 3 HOH 22 334 22 HOH HOH A . C 3 HOH 23 335 23 HOH HOH A . C 3 HOH 24 336 24 HOH HOH A . C 3 HOH 25 337 25 HOH HOH A . C 3 HOH 26 338 26 HOH HOH A . C 3 HOH 27 339 27 HOH HOH A . C 3 HOH 28 340 28 HOH HOH A . C 3 HOH 29 341 29 HOH HOH A . C 3 HOH 30 342 30 HOH HOH A . C 3 HOH 31 343 31 HOH HOH A . C 3 HOH 32 344 32 HOH HOH A . C 3 HOH 33 345 33 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SnB phasing . ? 4 SOLVE phasing . ? 5 # _cell.entry_id 1XTO _cell.length_a 86.051 _cell.length_b 86.051 _cell.length_c 110.666 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XTO _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1XTO _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.1 _exptl_crystal.density_percent_sol 59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_details '100 mM Tri-HCl (pH 8.5), 8% PEG 8k, and 5 mM DTT, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2004-08-23 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97897 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97897 # _reflns.entry_id 1XTO _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 29.34 _reflns.d_resolution_high 2.8 _reflns.number_obs 19503 _reflns.number_all 21150 _reflns.percent_possible_obs 99.0 _reflns.pdbx_Rmerge_I_obs 0.071 _reflns.pdbx_Rsym_value 0.052 _reflns.pdbx_netI_over_sigmaI 35.2 _reflns.B_iso_Wilson_estimate 48.5 _reflns.pdbx_redundancy 9.94 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.9 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.431 _reflns_shell.pdbx_Rsym_value 0.396 _reflns_shell.meanI_over_sigI_obs 6.6 _reflns_shell.pdbx_redundancy 9.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1964 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1XTO _refine.ls_number_reflns_obs 18513 _refine.ls_number_reflns_all 19503 _refine.pdbx_ls_sigma_I 2.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 230376.40 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.34 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 94.7 _refine.ls_R_factor_obs 0.227 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.227 _refine.ls_R_factor_R_free 0.282 _refine.ls_R_factor_R_free_error 0.007 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.5 _refine.ls_number_reflns_R_free 1765 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 49.7 _refine.aniso_B[1][1] -0.05 _refine.aniso_B[2][2] -0.05 _refine.aniso_B[3][3] 0.09 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.297003 _refine.solvent_model_param_bsol 19.9438 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model OVERALL _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1XTO _refine_analyze.Luzzati_coordinate_error_obs 0.35 _refine_analyze.Luzzati_sigma_a_obs 0.40 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.46 _refine_analyze.Luzzati_sigma_a_free 0.55 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2344 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 33 _refine_hist.number_atoms_total 2378 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 29.34 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.1 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 25.1 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.74 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 2.98 _refine_ls_shell.number_reflns_R_work 2532 _refine_ls_shell.R_factor_R_work 0.31 _refine_ls_shell.percent_reflns_obs 85.8 _refine_ls_shell.R_factor_R_free 0.378 _refine_ls_shell.R_factor_R_free_error 0.023 _refine_ls_shell.percent_reflns_R_free 9.8 _refine_ls_shell.number_reflns_R_free 275 _refine_ls_shell.number_reflns_obs 18513 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _database_PDB_matrix.entry_id 1XTO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1XTO _struct.title 'Crystal Structure of the Coenzyme PQQ Synthesis Protein (PqqB) from Pseudomonas putida, Northeast Structural Genomics Target PpR6' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XTO _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;alpha-beta protein, Northeast Structural Genomics Consortium, NESG, Protein Structure Initiative, PSI, Structural Genomics, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PQQB_PSEPK _struct_ref.pdbx_db_accession Q88QV5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTG INAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFP LRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGR EMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIEL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XTO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 303 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q88QV5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 303 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 303 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1XTO MSE A 1 ? UNP Q88QV5 MET 1 'modified residue' 1 1 1 1XTO MSE A 70 ? UNP Q88QV5 MET 70 'modified residue' 70 2 1 1XTO MSE A 113 ? UNP Q88QV5 MET 113 'modified residue' 113 3 1 1XTO MSE A 127 ? UNP Q88QV5 MET 127 'modified residue' 127 4 1 1XTO MSE A 184 ? UNP Q88QV5 MET 184 'modified residue' 184 5 1 1XTO MSE A 210 ? UNP Q88QV5 MET 210 'modified residue' 210 6 1 1XTO MSE A 211 ? UNP Q88QV5 MET 211 'modified residue' 211 7 1 1XTO MSE A 229 ? UNP Q88QV5 MET 229 'modified residue' 229 8 1 1XTO MSE A 242 ? UNP Q88QV5 MET 242 'modified residue' 242 9 1 1XTO MSE A 253 ? UNP Q88QV5 MET 253 'modified residue' 253 10 1 1XTO MSE A 299 ? UNP Q88QV5 MET 299 'modified residue' 299 11 1 1XTO LEU A 304 ? UNP Q88QV5 ? ? 'cloning artifact' 304 12 1 1XTO GLU A 305 ? UNP Q88QV5 ? ? 'cloning artifact' 305 13 1 1XTO HIS A 306 ? UNP Q88QV5 ? ? 'cloning artifact' 306 14 1 1XTO HIS A 307 ? UNP Q88QV5 ? ? 'cloning artifact' 307 15 1 1XTO HIS A 308 ? UNP Q88QV5 ? ? 'cloning artifact' 308 16 1 1XTO HIS A 309 ? UNP Q88QV5 ? ? 'cloning artifact' 309 17 1 1XTO HIS A 310 ? UNP Q88QV5 ? ? 'cloning artifact' 310 18 1 1XTO HIS A 311 ? UNP Q88QV5 ? ? 'cloning artifact' 311 19 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4230 ? 1 MORE -11 ? 1 'SSA (A^2)' 22220 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 110.6660000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 21 ? ASP A 29 ? CYS A 21 ASP A 29 1 ? 9 HELX_P HELX_P2 2 ASP A 59 ? ALA A 66 ? ASP A 59 ALA A 66 1 ? 8 HELX_P HELX_P3 3 PHE A 67 ? GLN A 71 ? PHE A 67 GLN A 71 5 ? 5 HELX_P HELX_P4 4 GLN A 90 ? THR A 95 ? GLN A 90 THR A 95 1 ? 6 HELX_P HELX_P5 5 GLY A 96 ? CYS A 104 ? GLY A 96 CYS A 104 5 ? 9 HELX_P HELX_P6 6 THR A 111 ? LEU A 118 ? THR A 111 LEU A 118 1 ? 8 HELX_P HELX_P7 7 PRO A 123 ? SER A 129 ? PRO A 123 SER A 129 1 ? 7 HELX_P HELX_P8 8 ASP A 204 ? HIS A 212 ? ASP A 204 HIS A 212 1 ? 9 HELX_P HELX_P9 9 ASP A 227 ? ARG A 232 ? ASP A 227 ARG A 232 1 ? 6 HELX_P HELX_P10 10 GLY A 252 ? LEU A 257 ? GLY A 252 LEU A 257 1 ? 6 HELX_P HELX_P11 11 ASP A 258 ? PHE A 260 ? ASP A 258 PHE A 260 5 ? 3 HELX_P HELX_P12 12 ASN A 274 ? ASP A 278 ? ASN A 274 ASP A 278 5 ? 5 HELX_P HELX_P13 13 SER A 281 ? ARG A 290 ? SER A 281 ARG A 290 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A TYR 2 N ? ? A MSE 1 A TYR 2 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A PRO 69 C ? ? ? 1_555 A MSE 70 N ? ? A PRO 69 A MSE 70 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? A MSE 70 C ? ? ? 1_555 A GLN 71 N ? ? A MSE 70 A GLN 71 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A ASP 112 C ? ? ? 1_555 A MSE 113 N ? ? A ASP 112 A MSE 113 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale5 covale both ? A MSE 113 C ? ? ? 1_555 A VAL 114 N ? ? A MSE 113 A VAL 114 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A ASN 126 C ? ? ? 1_555 A MSE 127 N ? ? A ASN 126 A MSE 127 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale7 covale both ? A MSE 127 C ? ? ? 1_555 A LEU 128 N ? ? A MSE 127 A LEU 128 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale8 covale both ? A LEU 183 C ? ? ? 1_555 A MSE 184 N ? ? A LEU 183 A MSE 184 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale9 covale both ? A MSE 184 C ? ? ? 1_555 A VAL 185 N ? ? A MSE 184 A VAL 185 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale10 covale both ? A ALA 209 C ? ? ? 1_555 A MSE 210 N ? ? A ALA 209 A MSE 210 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale11 covale both ? A MSE 210 C ? ? ? 1_555 A MSE 211 N ? ? A MSE 210 A MSE 211 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale12 covale both ? A MSE 211 C ? ? ? 1_555 A HIS 212 N ? ? A MSE 211 A HIS 212 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale13 covale both ? A GLU 228 C ? ? ? 1_555 A MSE 229 N ? ? A GLU 228 A MSE 229 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale14 covale both ? A MSE 229 C ? ? ? 1_555 A GLN 230 N ? ? A MSE 229 A GLN 230 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale15 covale both ? A GLU 241 C ? ? ? 1_555 A MSE 242 N ? ? A GLU 241 A MSE 242 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale16 covale both ? A MSE 242 C ? ? ? 1_555 A GLY 243 N ? ? A MSE 242 A GLY 243 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale17 covale both ? A GLY 252 C ? ? ? 1_555 A MSE 253 N ? ? A GLY 252 A MSE 253 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale18 covale both ? A MSE 253 C ? ? ? 1_555 A LEU 254 N ? ? A MSE 253 A LEU 254 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale19 covale both ? A GLY 298 C ? ? ? 1_555 A MSE 299 N ? ? A GLY 298 A MSE 299 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale20 covale both ? A MSE 299 C ? ? ? 1_555 A SER 300 N ? ? A MSE 299 A SER 300 1_555 ? ? ? ? ? ? ? 1.337 ? ? metalc1 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 312 1_555 ? ? ? ? ? ? ? 2.550 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 312 1_555 ? ? ? ? ? ? ? 2.541 ? ? metalc3 metalc ? ? A CYS 24 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 24 A ZN 312 1_555 ? ? ? ? ? ? ? 2.413 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 312 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 95.7 ? 2 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 312 ? 1_555 SG ? A CYS 24 ? A CYS 24 ? 1_555 124.5 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 312 ? 1_555 SG ? A CYS 24 ? A CYS 24 ? 1_555 102.5 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 14 A . ? PHE 14 A PRO 15 A ? PRO 15 A 1 0.16 2 CYS 104 A . ? CYS 104 A PRO 105 A ? PRO 105 A 1 0.01 3 GLY 249 A . ? GLY 249 A PRO 250 A ? PRO 250 A 1 0.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 135 ? ARG A 139 ? LEU A 135 ARG A 139 A 2 HIS A 106 ? CYS A 110 ? HIS A 106 CYS A 110 A 3 ILE A 81 ? VAL A 85 ? ILE A 81 VAL A 85 A 4 TRP A 51 ? CYS A 54 ? TRP A 51 CYS A 54 A 5 SER A 41 ? SER A 45 ? SER A 41 SER A 45 A 6 TYR A 2 ? GLY A 7 ? TYR A 2 GLY A 7 A 7 SER A 300 ? GLU A 302 ? SER A 300 GLU A 302 B 1 LEU A 154 ? PRO A 160 ? LEU A 154 PRO A 160 B 2 LEU A 181 ? ASP A 187 ? LEU A 181 ASP A 187 B 3 LYS A 193 ? ALA A 197 ? LYS A 193 ALA A 197 B 4 CYS A 216 ? ASP A 220 ? CYS A 216 ASP A 220 B 5 ARG A 264 ? ILE A 268 ? ARG A 264 ILE A 268 B 6 VAL A 292 ? VAL A 294 ? VAL A 292 VAL A 294 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 136 ? O GLN A 136 N HIS A 106 ? N HIS A 106 A 2 3 O TRP A 109 ? O TRP A 109 N ILE A 84 ? N ILE A 84 A 3 4 O VAL A 85 ? O VAL A 85 N LEU A 53 ? N LEU A 53 A 4 5 O ILE A 52 ? O ILE A 52 N LEU A 44 ? N LEU A 44 A 5 6 O SER A 41 ? O SER A 41 N GLY A 7 ? N GLY A 7 A 6 7 N ILE A 3 ? N ILE A 3 O ILE A 301 ? O ILE A 301 B 1 2 N LYS A 155 ? N LYS A 155 O GLU A 186 ? O GLU A 186 B 2 3 N VAL A 185 ? N VAL A 185 O LEU A 194 ? O LEU A 194 B 3 4 N PHE A 195 ? N PHE A 195 O CYS A 216 ? O CYS A 216 B 4 5 N LEU A 217 ? N LEU A 217 O ARG A 264 ? O ARG A 264 B 5 6 N LEU A 267 ? N LEU A 267 O GLU A 293 ? O GLU A 293 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 312 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 312' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 19 ? CYS A 19 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 CYS A 24 ? CYS A 24 . ? 1_555 ? 4 AC1 4 ASN A 272 ? ASN A 272 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 31 ? ? -106.63 45.46 2 1 LEU A 32 ? ? -172.40 118.88 3 1 SER A 41 ? ? 177.78 133.11 4 1 ASN A 55 ? ? 71.82 126.34 5 1 ALA A 75 ? ? 175.77 152.05 6 1 ARG A 77 ? ? 49.64 79.97 7 1 ASP A 88 ? ? -177.55 -175.48 8 1 THR A 120 ? ? -135.37 -88.20 9 1 PRO A 123 ? ? -62.76 54.87 10 1 ASN A 132 ? ? 39.06 70.19 11 1 ARG A 162 ? ? -39.08 98.04 12 1 PRO A 167 ? ? -58.07 -9.16 13 1 ALA A 197 ? ? -154.62 72.81 14 1 GLN A 202 ? ? -172.96 131.25 15 1 ASP A 204 ? ? -133.39 -153.98 16 1 LEU A 218 ? ? -102.14 79.73 17 1 ARG A 237 ? ? -51.61 178.20 18 1 ARG A 240 ? ? -161.20 -34.16 19 1 MSE A 242 ? ? 67.76 75.87 20 1 HIS A 244 ? ? -114.71 -166.18 21 1 LEU A 245 ? ? 61.33 90.31 22 1 ALA A 246 ? ? -57.12 -178.08 23 1 GLN A 263 ? ? 178.34 151.42 24 1 ARG A 290 ? ? -59.91 -2.13 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 70 A MSE 70 ? MET SELENOMETHIONINE 3 A MSE 113 A MSE 113 ? MET SELENOMETHIONINE 4 A MSE 127 A MSE 127 ? MET SELENOMETHIONINE 5 A MSE 184 A MSE 184 ? MET SELENOMETHIONINE 6 A MSE 210 A MSE 210 ? MET SELENOMETHIONINE 7 A MSE 211 A MSE 211 ? MET SELENOMETHIONINE 8 A MSE 229 A MSE 229 ? MET SELENOMETHIONINE 9 A MSE 242 A MSE 242 ? MET SELENOMETHIONINE 10 A MSE 253 A MSE 253 ? MET SELENOMETHIONINE 11 A MSE 299 A MSE 299 ? MET SELENOMETHIONINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 305 ? A GLU 305 2 1 Y 1 A HIS 306 ? A HIS 306 3 1 Y 1 A HIS 307 ? A HIS 307 4 1 Y 1 A HIS 308 ? A HIS 308 5 1 Y 1 A HIS 309 ? A HIS 309 6 1 Y 1 A HIS 310 ? A HIS 310 7 1 Y 1 A HIS 311 ? A HIS 311 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MSE N N N N 250 MSE CA C N S 251 MSE C C N N 252 MSE O O N N 253 MSE OXT O N N 254 MSE CB C N N 255 MSE CG C N N 256 MSE SE SE N N 257 MSE CE C N N 258 MSE H H N N 259 MSE H2 H N N 260 MSE HA H N N 261 MSE HXT H N N 262 MSE HB2 H N N 263 MSE HB3 H N N 264 MSE HG2 H N N 265 MSE HG3 H N N 266 MSE HE1 H N N 267 MSE HE2 H N N 268 MSE HE3 H N N 269 PHE N N N N 270 PHE CA C N S 271 PHE C C N N 272 PHE O O N N 273 PHE CB C N N 274 PHE CG C Y N 275 PHE CD1 C Y N 276 PHE CD2 C Y N 277 PHE CE1 C Y N 278 PHE CE2 C Y N 279 PHE CZ C Y N 280 PHE OXT O N N 281 PHE H H N N 282 PHE H2 H N N 283 PHE HA H N N 284 PHE HB2 H N N 285 PHE HB3 H N N 286 PHE HD1 H N N 287 PHE HD2 H N N 288 PHE HE1 H N N 289 PHE HE2 H N N 290 PHE HZ H N N 291 PHE HXT H N N 292 PRO N N N N 293 PRO CA C N S 294 PRO C C N N 295 PRO O O N N 296 PRO CB C N N 297 PRO CG C N N 298 PRO CD C N N 299 PRO OXT O N N 300 PRO H H N N 301 PRO HA H N N 302 PRO HB2 H N N 303 PRO HB3 H N N 304 PRO HG2 H N N 305 PRO HG3 H N N 306 PRO HD2 H N N 307 PRO HD3 H N N 308 PRO HXT H N N 309 SER N N N N 310 SER CA C N S 311 SER C C N N 312 SER O O N N 313 SER CB C N N 314 SER OG O N N 315 SER OXT O N N 316 SER H H N N 317 SER H2 H N N 318 SER HA H N N 319 SER HB2 H N N 320 SER HB3 H N N 321 SER HG H N N 322 SER HXT H N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 ZN ZN ZN N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 MSE N CA sing N N 237 MSE N H sing N N 238 MSE N H2 sing N N 239 MSE CA C sing N N 240 MSE CA CB sing N N 241 MSE CA HA sing N N 242 MSE C O doub N N 243 MSE C OXT sing N N 244 MSE OXT HXT sing N N 245 MSE CB CG sing N N 246 MSE CB HB2 sing N N 247 MSE CB HB3 sing N N 248 MSE CG SE sing N N 249 MSE CG HG2 sing N N 250 MSE CG HG3 sing N N 251 MSE SE CE sing N N 252 MSE CE HE1 sing N N 253 MSE CE HE2 sing N N 254 MSE CE HE3 sing N N 255 PHE N CA sing N N 256 PHE N H sing N N 257 PHE N H2 sing N N 258 PHE CA C sing N N 259 PHE CA CB sing N N 260 PHE CA HA sing N N 261 PHE C O doub N N 262 PHE C OXT sing N N 263 PHE CB CG sing N N 264 PHE CB HB2 sing N N 265 PHE CB HB3 sing N N 266 PHE CG CD1 doub Y N 267 PHE CG CD2 sing Y N 268 PHE CD1 CE1 sing Y N 269 PHE CD1 HD1 sing N N 270 PHE CD2 CE2 doub Y N 271 PHE CD2 HD2 sing N N 272 PHE CE1 CZ doub Y N 273 PHE CE1 HE1 sing N N 274 PHE CE2 CZ sing Y N 275 PHE CE2 HE2 sing N N 276 PHE CZ HZ sing N N 277 PHE OXT HXT sing N N 278 PRO N CA sing N N 279 PRO N CD sing N N 280 PRO N H sing N N 281 PRO CA C sing N N 282 PRO CA CB sing N N 283 PRO CA HA sing N N 284 PRO C O doub N N 285 PRO C OXT sing N N 286 PRO CB CG sing N N 287 PRO CB HB2 sing N N 288 PRO CB HB3 sing N N 289 PRO CG CD sing N N 290 PRO CG HG2 sing N N 291 PRO CG HG3 sing N N 292 PRO CD HD2 sing N N 293 PRO CD HD3 sing N N 294 PRO OXT HXT sing N N 295 SER N CA sing N N 296 SER N H sing N N 297 SER N H2 sing N N 298 SER CA C sing N N 299 SER CA CB sing N N 300 SER CA HA sing N N 301 SER C O doub N N 302 SER C OXT sing N N 303 SER CB OG sing N N 304 SER CB HB2 sing N N 305 SER CB HB3 sing N N 306 SER OG HG sing N N 307 SER OXT HXT sing N N 308 THR N CA sing N N 309 THR N H sing N N 310 THR N H2 sing N N 311 THR CA C sing N N 312 THR CA CB sing N N 313 THR CA HA sing N N 314 THR C O doub N N 315 THR C OXT sing N N 316 THR CB OG1 sing N N 317 THR CB CG2 sing N N 318 THR CB HB sing N N 319 THR OG1 HG1 sing N N 320 THR CG2 HG21 sing N N 321 THR CG2 HG22 sing N N 322 THR CG2 HG23 sing N N 323 THR OXT HXT sing N N 324 TRP N CA sing N N 325 TRP N H sing N N 326 TRP N H2 sing N N 327 TRP CA C sing N N 328 TRP CA CB sing N N 329 TRP CA HA sing N N 330 TRP C O doub N N 331 TRP C OXT sing N N 332 TRP CB CG sing N N 333 TRP CB HB2 sing N N 334 TRP CB HB3 sing N N 335 TRP CG CD1 doub Y N 336 TRP CG CD2 sing Y N 337 TRP CD1 NE1 sing Y N 338 TRP CD1 HD1 sing N N 339 TRP CD2 CE2 doub Y N 340 TRP CD2 CE3 sing Y N 341 TRP NE1 CE2 sing Y N 342 TRP NE1 HE1 sing N N 343 TRP CE2 CZ2 sing Y N 344 TRP CE3 CZ3 doub Y N 345 TRP CE3 HE3 sing N N 346 TRP CZ2 CH2 doub Y N 347 TRP CZ2 HZ2 sing N N 348 TRP CZ3 CH2 sing Y N 349 TRP CZ3 HZ3 sing N N 350 TRP CH2 HH2 sing N N 351 TRP OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _atom_sites.entry_id 1XTO _atom_sites.fract_transf_matrix[1][1] 0.011621 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011621 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009036 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE ZN # loop_