data_1XWM # _entry.id 1XWM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1XWM RCSB RCSB030850 WWPDB D_1000030850 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC36012 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XWM _pdbx_database_status.recvd_initial_deposition_date 2004-11-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, R.' 1 'Dementieva, I.' 2 'Moy, S.' 3 'Joachimiak, A.' 4 'Midwest Center for Structural Genomics (MCSG)' 5 # _citation.id primary _citation.title 'The crystal structure of PhoU (phosphate uptake regulator)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhang, R.' 1 primary 'Dementieva, I.' 2 primary 'Moy, S.' 3 primary 'Joachimiak, A.' 4 # _cell.entry_id 1XWM _cell.length_a 61.172 _cell.length_b 61.172 _cell.length_c 121.264 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XWM _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'phosphate uptake regulator' 23804.146 1 ? ? ? ? 2 water nat water 18.015 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PhoU # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRETFADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALWLIAAQQPVATDLRRI VAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDREDASLAAQIADMDHRVDEQYG EMMASLLAVAKTDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKGKHYDFND ; _entity_poly.pdbx_seq_one_letter_code_can ;MRETFADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALWLIAAQQPVATDLRRI VAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDREDASLAAQIADMDHRVDEQYG EMMASLLAVAKTDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKGKHYDFND ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC36012 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLU n 1 4 THR n 1 5 PHE n 1 6 ALA n 1 7 ASP n 1 8 ASP n 1 9 LEU n 1 10 ALA n 1 11 SER n 1 12 LEU n 1 13 HIS n 1 14 ASN n 1 15 LYS n 1 16 LEU n 1 17 ILE n 1 18 GLU n 1 19 MET n 1 20 GLY n 1 21 ARG n 1 22 LEU n 1 23 THR n 1 24 GLU n 1 25 VAL n 1 26 ALA n 1 27 LEU n 1 28 GLN n 1 29 GLN n 1 30 ALA n 1 31 ILE n 1 32 GLU n 1 33 ALA n 1 34 PHE n 1 35 GLN n 1 36 THR n 1 37 GLN n 1 38 ASN n 1 39 ALA n 1 40 ASN n 1 41 LEU n 1 42 ALA n 1 43 MET n 1 44 ALA n 1 45 VAL n 1 46 ILE n 1 47 ASP n 1 48 GLY n 1 49 ASP n 1 50 GLY n 1 51 SER n 1 52 ILE n 1 53 ASP n 1 54 ALA n 1 55 LEU n 1 56 GLU n 1 57 GLU n 1 58 GLU n 1 59 VAL n 1 60 ASN n 1 61 ASP n 1 62 PHE n 1 63 ALA n 1 64 LEU n 1 65 TRP n 1 66 LEU n 1 67 ILE n 1 68 ALA n 1 69 ALA n 1 70 GLN n 1 71 GLN n 1 72 PRO n 1 73 VAL n 1 74 ALA n 1 75 THR n 1 76 ASP n 1 77 LEU n 1 78 ARG n 1 79 ARG n 1 80 ILE n 1 81 VAL n 1 82 ALA n 1 83 ALA n 1 84 ILE n 1 85 LYS n 1 86 ILE n 1 87 ALA n 1 88 SER n 1 89 ASP n 1 90 ILE n 1 91 GLU n 1 92 ARG n 1 93 ILE n 1 94 ALA n 1 95 ASP n 1 96 PHE n 1 97 ALA n 1 98 VAL n 1 99 ASN n 1 100 ILE n 1 101 ALA n 1 102 LYS n 1 103 ALA n 1 104 CYS n 1 105 ILE n 1 106 ARG n 1 107 ILE n 1 108 GLY n 1 109 GLY n 1 110 GLN n 1 111 PRO n 1 112 PHE n 1 113 VAL n 1 114 MET n 1 115 ASP n 1 116 ILE n 1 117 GLY n 1 118 PRO n 1 119 LEU n 1 120 VAL n 1 121 LEU n 1 122 MET n 1 123 TYR n 1 124 ARG n 1 125 LEU n 1 126 ALA n 1 127 THR n 1 128 ASP n 1 129 MET n 1 130 VAL n 1 131 SER n 1 132 THR n 1 133 ALA n 1 134 ILE n 1 135 ALA n 1 136 ALA n 1 137 TYR n 1 138 ASP n 1 139 ARG n 1 140 GLU n 1 141 ASP n 1 142 ALA n 1 143 SER n 1 144 LEU n 1 145 ALA n 1 146 ALA n 1 147 GLN n 1 148 ILE n 1 149 ALA n 1 150 ASP n 1 151 MET n 1 152 ASP n 1 153 HIS n 1 154 ARG n 1 155 VAL n 1 156 ASP n 1 157 GLU n 1 158 GLN n 1 159 TYR n 1 160 GLY n 1 161 GLU n 1 162 MET n 1 163 MET n 1 164 ALA n 1 165 SER n 1 166 LEU n 1 167 LEU n 1 168 ALA n 1 169 VAL n 1 170 ALA n 1 171 LYS n 1 172 THR n 1 173 ASP n 1 174 ALA n 1 175 ALA n 1 176 THR n 1 177 LEU n 1 178 ALA n 1 179 GLN n 1 180 MET n 1 181 ASN n 1 182 VAL n 1 183 LEU n 1 184 ALA n 1 185 LEU n 1 186 VAL n 1 187 ALA n 1 188 ARG n 1 189 TYR n 1 190 ILE n 1 191 GLU n 1 192 ARG n 1 193 THR n 1 194 ALA n 1 195 ASP n 1 196 HIS n 1 197 ALA n 1 198 THR n 1 199 ASN n 1 200 ILE n 1 201 ALA n 1 202 GLU n 1 203 HIS n 1 204 LEU n 1 205 VAL n 1 206 TYR n 1 207 LEU n 1 208 VAL n 1 209 LYS n 1 210 GLY n 1 211 LYS n 1 212 HIS n 1 213 TYR n 1 214 ASP n 1 215 PHE n 1 216 ASN n 1 217 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Geobacillus _entity_src_gen.pdbx_gene_src_gene RBSTP1653 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus stearothermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1422 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PDM68 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 1XWM _struct_ref.pdbx_db_accession 1XWM _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XWM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 217 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 1XWM _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 217 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 217 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1XWM _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_percent_sol 44.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.9 _exptl_crystal_grow.pdbx_details '16% PEG3350, 0.2M ammonium tartrate, 0.1M Bis-Tris buffer, pH 5.9, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC-2 _diffrn_detector.pdbx_collection_date 2003-11-19 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 channel' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9795 1.0 2 0.94656 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9795, 0.94656' # _reflns.entry_id 1XWM _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.5 _reflns.number_obs 15295 _reflns.number_all 15341 _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.104 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 22.6 _reflns.B_iso_Wilson_estimate 23.3 _reflns.pdbx_redundancy 8.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all 98.6 _reflns_shell.Rmerge_I_obs 0.667 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.87 _reflns_shell.pdbx_redundancy 7.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1524 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1XWM _refine.ls_number_reflns_obs 14024 _refine.ls_number_reflns_all 15243 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 342821.05 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.59 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 92.0 _refine.ls_R_factor_obs 0.243 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.243 _refine.ls_R_factor_R_free 0.334 _refine.ls_R_factor_R_free_error 0.013 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 691 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 49.3 _refine.aniso_B[1][1] 6.02 _refine.aniso_B[2][2] 6.02 _refine.aniso_B[3][3] -12.04 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.309509 _refine.solvent_model_param_bsol 42.6805 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1XWM _refine_analyze.Luzzati_coordinate_error_obs 0.39 _refine_analyze.Luzzati_sigma_a_obs 0.59 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.47 _refine_analyze.Luzzati_sigma_a_free 0.39 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1621 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 1626 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 30.59 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 18.3 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.94 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.50 _refine_ls_shell.d_res_low 2.66 _refine_ls_shell.number_reflns_R_work 1781 _refine_ls_shell.R_factor_R_work 0.346 _refine_ls_shell.percent_reflns_obs 72.7 _refine_ls_shell.R_factor_R_free 0.392 _refine_ls_shell.R_factor_R_free_error 0.037 _refine_ls_shell.percent_reflns_R_free 4.7 _refine_ls_shell.number_reflns_R_free 87 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM ? 'X-RAY DIFFRACTION' 3 ION.PARAM ? 'X-RAY DIFFRACTION' # _struct.entry_id 1XWM _struct.title 'The crystal structure of PhoU (phosphate uptake regulator), Structural genomics' _struct.pdbx_descriptor 'phosphate uptake regulator' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XWM _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;PhoU, Negative phosphate uptake regulator, Structural genomics, protein structure initiative, PSI, MCSG, Midwest center for structural genomics, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'This protein exists as dimer. The second part of the dimer is generated by crystallographic two fold axis.' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 4 ? GLN A 37 ? THR A 4 GLN A 37 1 ? 34 HELX_P HELX_P2 2 ASN A 38 ? GLY A 48 ? ASN A 38 GLY A 48 1 ? 11 HELX_P HELX_P3 3 ASP A 49 ? ALA A 69 ? ASP A 49 ALA A 69 1 ? 21 HELX_P HELX_P4 4 VAL A 73 ? ILE A 107 ? VAL A 73 ILE A 107 1 ? 35 HELX_P HELX_P5 5 ILE A 116 ? GLU A 140 ? ILE A 116 GLU A 140 1 ? 25 HELX_P HELX_P6 6 SER A 143 ? ALA A 168 ? SER A 143 ALA A 168 1 ? 26 HELX_P HELX_P7 7 ASP A 173 ? GLY A 210 ? ASP A 173 GLY A 210 1 ? 38 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1XWM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XWM _atom_sites.fract_transf_matrix[1][1] 0.016347 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016347 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008246 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 CYS 104 104 104 CYS CYS A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 MET 151 151 151 MET MET A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 GLN 179 179 179 GLN GLN A . n A 1 180 MET 180 180 180 MET MET A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 ARG 192 192 192 ARG ARG A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 HIS 203 203 203 HIS HIS A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 HIS 212 212 212 HIS HIS A . n A 1 213 TYR 213 213 213 TYR TYR A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 PHE 215 215 215 PHE PHE A . n A 1 216 ASN 216 216 ? ? ? A . n A 1 217 ASP 217 217 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-12-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 SBC-Collect 'data collection' . ? 2 HKL-2000 'data scaling' . ? 3 CNS phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 69 ? ? -108.62 -72.99 2 1 GLN A 70 ? ? -69.67 3.97 3 1 ALA A 74 ? ? -6.41 -71.92 4 1 GLN A 110 ? ? -112.71 54.50 5 1 PRO A 111 ? ? 24.27 126.26 6 1 ASP A 138 ? ? -52.22 -70.82 7 1 GLU A 140 ? ? 73.09 43.08 8 1 ALA A 145 ? ? -45.76 -73.79 9 1 GLU A 161 ? ? -61.24 8.39 10 1 ALA A 164 ? ? -53.49 -79.75 11 1 SER A 165 ? ? -56.07 -2.72 12 1 LEU A 166 ? ? -100.88 -72.91 13 1 LEU A 167 ? ? -68.00 2.56 14 1 ALA A 168 ? ? -91.88 -63.01 15 1 VAL A 169 ? ? -37.52 114.21 16 1 LYS A 171 ? ? 166.36 53.81 17 1 VAL A 208 ? ? -80.36 -76.03 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A ASN 216 ? A ASN 216 5 1 Y 1 A ASP 217 ? A ASP 217 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 301 HOH TIP A . B 2 HOH 2 302 302 HOH TIP A . B 2 HOH 3 303 303 HOH TIP A . B 2 HOH 4 304 304 HOH TIP A . B 2 HOH 5 305 305 HOH TIP A . #