data_1XXE # _entry.id 1XXE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XXE pdb_00001xxe 10.2210/pdb1xxe/pdb RCSB RCSB030875 ? ? WWPDB D_1000030875 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.pdb_id 1XXE _pdbx_database_PDB_obs_spr.replace_pdb_id 1NZT _pdbx_database_PDB_obs_spr.date 2004-11-23 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XXE _pdbx_database_status.recvd_initial_deposition_date 2004-11-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry N _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Coggins, B.E.' 1 'McClerren, A.L.' 2 'Jiang, L.' 3 'Li, X.' 4 'Rudolph, J.' 5 'Hindsgaul, O.' 6 'Raetz, C.R.H.' 7 'Zhou, P.' 8 # _citation.id primary _citation.title ;Refined Solution Structure of the LpxC-TU-514 Complex and pK(a) Analysis of an Active Site Histidine: Insights into the Mechanism and Inhibitor Design ; _citation.journal_abbrev Biochemistry _citation.journal_volume 44 _citation.page_first 1114 _citation.page_last 1126 _citation.year 2005 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15667205 _citation.pdbx_database_id_DOI 10.1021/bi047820z # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Coggins, B.E.' 1 ? primary 'McClerren, A.L.' 2 ? primary 'Jiang, L.' 3 ? primary 'Li, X.' 4 ? primary 'Rudolph, J.' 5 ? primary 'Hindsgaul, O.' 6 ? primary 'Raetz, C.R.H.' 7 ? primary 'Zhou, P.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase' 32193.916 1 3.5.1.- ? ? 'complexed with TU-514' 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn '1,5-ANHYDRO-2-C-(CARBOXYMETHYL-N-HYDROXYAMIDE)-2-DEOXY-3-O-MYRISTOYL-D-GLUCITOL' 431.563 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UDP-3-O-acyl-GlcNAc deacetylase' # _entity_name_sys.entity_id 1 _entity_name_sys.name E.C.3.5.1.- # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGLEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNGVYIPARHEFVVHTNHSTDLGFKGQRIKTVEHILSVLH LLEITNVTIEVIGNEIPILDGSGWEFYEAIRKNILNQNREIDYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKNFLG RQKFTFVEGNEEEIVLARTFCFDWEIEHIKKVGLGKGGSLKNTLVLGKDKVYNPEGLRYENEPVRHKVFDLIGDLYLLGS PVKGKFYSFRGGHSLNVKLVKELAKKQKLTRDLPHLPSVQAL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGLEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNGVYIPARHEFVVHTNHSTDLGFKGQRIKTVEHILSVLH LLEITNVTIEVIGNEIPILDGSGWEFYEAIRKNILNQNREIDYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKNFLG RQKFTFVEGNEEEIVLARTFCFDWEIEHIKKVGLGKGGSLKNTLVLGKDKVYNPEGLRYENEPVRHKVFDLIGDLYLLGS PVKGKFYSFRGGHSLNVKLVKELAKKQKLTRDLPHLPSVQAL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LEU n 1 4 GLU n 1 5 LYS n 1 6 THR n 1 7 VAL n 1 8 LYS n 1 9 GLU n 1 10 LYS n 1 11 LEU n 1 12 SER n 1 13 PHE n 1 14 GLU n 1 15 GLY n 1 16 VAL n 1 17 GLY n 1 18 ILE n 1 19 HIS n 1 20 THR n 1 21 GLY n 1 22 GLU n 1 23 TYR n 1 24 SER n 1 25 LYS n 1 26 LEU n 1 27 ILE n 1 28 ILE n 1 29 HIS n 1 30 PRO n 1 31 GLU n 1 32 LYS n 1 33 GLU n 1 34 GLY n 1 35 THR n 1 36 GLY n 1 37 ILE n 1 38 ARG n 1 39 PHE n 1 40 PHE n 1 41 LYS n 1 42 ASN n 1 43 GLY n 1 44 VAL n 1 45 TYR n 1 46 ILE n 1 47 PRO n 1 48 ALA n 1 49 ARG n 1 50 HIS n 1 51 GLU n 1 52 PHE n 1 53 VAL n 1 54 VAL n 1 55 HIS n 1 56 THR n 1 57 ASN n 1 58 HIS n 1 59 SER n 1 60 THR n 1 61 ASP n 1 62 LEU n 1 63 GLY n 1 64 PHE n 1 65 LYS n 1 66 GLY n 1 67 GLN n 1 68 ARG n 1 69 ILE n 1 70 LYS n 1 71 THR n 1 72 VAL n 1 73 GLU n 1 74 HIS n 1 75 ILE n 1 76 LEU n 1 77 SER n 1 78 VAL n 1 79 LEU n 1 80 HIS n 1 81 LEU n 1 82 LEU n 1 83 GLU n 1 84 ILE n 1 85 THR n 1 86 ASN n 1 87 VAL n 1 88 THR n 1 89 ILE n 1 90 GLU n 1 91 VAL n 1 92 ILE n 1 93 GLY n 1 94 ASN n 1 95 GLU n 1 96 ILE n 1 97 PRO n 1 98 ILE n 1 99 LEU n 1 100 ASP n 1 101 GLY n 1 102 SER n 1 103 GLY n 1 104 TRP n 1 105 GLU n 1 106 PHE n 1 107 TYR n 1 108 GLU n 1 109 ALA n 1 110 ILE n 1 111 ARG n 1 112 LYS n 1 113 ASN n 1 114 ILE n 1 115 LEU n 1 116 ASN n 1 117 GLN n 1 118 ASN n 1 119 ARG n 1 120 GLU n 1 121 ILE n 1 122 ASP n 1 123 TYR n 1 124 PHE n 1 125 VAL n 1 126 VAL n 1 127 GLU n 1 128 GLU n 1 129 PRO n 1 130 ILE n 1 131 ILE n 1 132 VAL n 1 133 GLU n 1 134 ASP n 1 135 GLU n 1 136 GLY n 1 137 ARG n 1 138 LEU n 1 139 ILE n 1 140 LYS n 1 141 ALA n 1 142 GLU n 1 143 PRO n 1 144 SER n 1 145 ASP n 1 146 THR n 1 147 LEU n 1 148 GLU n 1 149 VAL n 1 150 THR n 1 151 TYR n 1 152 GLU n 1 153 GLY n 1 154 GLU n 1 155 PHE n 1 156 LYS n 1 157 ASN n 1 158 PHE n 1 159 LEU n 1 160 GLY n 1 161 ARG n 1 162 GLN n 1 163 LYS n 1 164 PHE n 1 165 THR n 1 166 PHE n 1 167 VAL n 1 168 GLU n 1 169 GLY n 1 170 ASN n 1 171 GLU n 1 172 GLU n 1 173 GLU n 1 174 ILE n 1 175 VAL n 1 176 LEU n 1 177 ALA n 1 178 ARG n 1 179 THR n 1 180 PHE n 1 181 CYS n 1 182 PHE n 1 183 ASP n 1 184 TRP n 1 185 GLU n 1 186 ILE n 1 187 GLU n 1 188 HIS n 1 189 ILE n 1 190 LYS n 1 191 LYS n 1 192 VAL n 1 193 GLY n 1 194 LEU n 1 195 GLY n 1 196 LYS n 1 197 GLY n 1 198 GLY n 1 199 SER n 1 200 LEU n 1 201 LYS n 1 202 ASN n 1 203 THR n 1 204 LEU n 1 205 VAL n 1 206 LEU n 1 207 GLY n 1 208 LYS n 1 209 ASP n 1 210 LYS n 1 211 VAL n 1 212 TYR n 1 213 ASN n 1 214 PRO n 1 215 GLU n 1 216 GLY n 1 217 LEU n 1 218 ARG n 1 219 TYR n 1 220 GLU n 1 221 ASN n 1 222 GLU n 1 223 PRO n 1 224 VAL n 1 225 ARG n 1 226 HIS n 1 227 LYS n 1 228 VAL n 1 229 PHE n 1 230 ASP n 1 231 LEU n 1 232 ILE n 1 233 GLY n 1 234 ASP n 1 235 LEU n 1 236 TYR n 1 237 LEU n 1 238 LEU n 1 239 GLY n 1 240 SER n 1 241 PRO n 1 242 VAL n 1 243 LYS n 1 244 GLY n 1 245 LYS n 1 246 PHE n 1 247 TYR n 1 248 SER n 1 249 PHE n 1 250 ARG n 1 251 GLY n 1 252 GLY n 1 253 HIS n 1 254 SER n 1 255 LEU n 1 256 ASN n 1 257 VAL n 1 258 LYS n 1 259 LEU n 1 260 VAL n 1 261 LYS n 1 262 GLU n 1 263 LEU n 1 264 ALA n 1 265 LYS n 1 266 LYS n 1 267 GLN n 1 268 LYS n 1 269 LEU n 1 270 THR n 1 271 ARG n 1 272 ASP n 1 273 LEU n 1 274 PRO n 1 275 HIS n 1 276 LEU n 1 277 PRO n 1 278 SER n 1 279 VAL n 1 280 GLN n 1 281 ALA n 1 282 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Aquifex _entity_src_gen.pdbx_gene_src_gene LpxC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aquifex aeolicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 63363 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)STAR' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code LPXC_AQUAE _struct_ref.pdbx_db_accession O67648 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MGLEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNGVYIPARHEFVVHTNHSTDLGFKGQRIKTVEHILSVLH LLEITNVTIEVIGNEIPILDGSGWEFYEAIRKNILNQNREIDYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKNFLG RQKFTFVEGNEEEIVLARTFCFDWEIEHIKKVGLGKGGSLKNTLVLGKDKVYNPEGLRYENEPVRHKVFDLIGDLYLLGS PVKGKFYSFRGGHSLNVKLVKELAKKQKLTRDLPHLPSVQAL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XXE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 282 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O67648 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 282 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 282 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TUX non-polymer . '1,5-ANHYDRO-2-C-(CARBOXYMETHYL-N-HYDROXYAMIDE)-2-DEOXY-3-O-MYRISTOYL-D-GLUCITOL' TU-514 'C22 H41 N O7' 431.563 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 4 4 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY 3 3 3 3D_13C-separated_NOESY 4 3 3 RDC 5 4 4 'HNCO-based RDC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.5 mM U-15N/13C AaLpxC/TU-514' '25 mM sodium phosphate, pH 6.5, 100 mM KCl, 2 mM DTT, 5% deuterated-DMSO and 5% D2O' 2 '0.5 mM deuterated, 15N/13C, VIL-methyl protonated AaLpxC with TU-514' '25 mM sodium phosphate, pH 6.5, 100 mM KCl, 2 mM DTT, 5% deuterated-DMSO and 5% D2O' 3 '13C-TU514/15N AaLpxC' '25 mM sodium phosphate, pH 6.5, 100 mM KCl, 2 mM DTT, 5% deuterated-DMSO and 95% D2O' 4 '0.5 mM U-15N AaLpxC/TU-514' '25 mM sodium phosphate, pH 6.5, 100 mM KCl, 2 mM DTT, 5% deuterated-DMSO and 5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 800 # _pdbx_nmr_refine.entry_id 1XXE _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1XXE _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1XXE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' 'Guntert P., Mumenthaler C., Wuthrich K.' 1 XPLOR-NIH 2.9.7 refinement 'Schwieters C.D., Kuszewski J.J., Tjandra N., Marius Clore G.' 2 # _exptl.entry_id 1XXE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1XXE _struct.title 'RDC refined solution structure of the AaLpxC/TU-514 complex' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XXE _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;LpxC; TU-514; LPS; lipid A; lipopolysaccharide UDP-3-O-acyl-N-acetylglucosamine deacetylase; metalloamidase; zinc metalloamidase, HYDROLASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 73 ? LEU A 82 ? GLU A 73 LEU A 82 1 ? 10 HELX_P HELX_P2 2 GLY A 103 ? LYS A 112 ? GLY A 103 LYS A 112 1 ? 10 HELX_P HELX_P3 3 GLU A 171 ? ILE A 174 ? GLU A 171 ILE A 174 5 ? 4 HELX_P HELX_P4 4 ASP A 183 ? LYS A 191 ? ASP A 183 LYS A 191 1 ? 9 HELX_P HELX_P5 5 GLU A 222 ? LEU A 235 ? GLU A 222 LEU A 235 1 ? 14 HELX_P HELX_P6 6 HIS A 253 ? LYS A 266 ? HIS A 253 LYS A 266 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 74 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 74 A ZN 319 1_555 ? ? ? ? ? ? ? 2.509 ? ? metalc2 metalc ? ? A HIS 226 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 226 A ZN 319 1_555 ? ? ? ? ? ? ? 2.512 ? ? metalc3 metalc ? ? A ASP 230 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 230 A ZN 319 1_555 ? ? ? ? ? ? ? 2.453 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C TUX . OYH ? ? A ZN 319 A TUX 320 1_555 ? ? ? ? ? ? ? 2.626 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 C TUX . OXH ? ? A ZN 319 A TUX 320 1_555 ? ? ? ? ? ? ? 2.670 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? C ? 3 ? D ? 2 ? E ? 5 ? F ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? parallel E 1 2 ? anti-parallel E 2 3 ? anti-parallel E 3 4 ? parallel E 4 5 ? anti-parallel F 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 5 ? VAL A 7 ? LYS A 5 VAL A 7 A 2 ILE A 114 ? ASN A 116 ? ILE A 114 ASN A 116 B 1 LEU A 11 ? VAL A 16 ? LEU A 11 VAL A 16 B 2 TYR A 23 ? PRO A 30 ? TYR A 23 PRO A 30 B 3 ASN A 86 ? ILE A 92 ? ASN A 86 ILE A 92 B 4 GLY A 36 ? LYS A 41 ? GLY A 36 LYS A 41 B 5 VAL A 44 ? PRO A 47 ? VAL A 44 PRO A 47 C 1 VAL A 53 ? THR A 56 ? VAL A 53 THR A 56 C 2 THR A 60 ? PHE A 64 ? THR A 60 PHE A 64 C 3 GLN A 67 ? ILE A 69 ? GLN A 67 ILE A 69 D 1 PHE A 124 ? VAL A 125 ? PHE A 124 VAL A 125 D 2 VAL A 242 ? LYS A 243 ? VAL A 242 LYS A 243 E 1 ILE A 130 ? ASP A 134 ? ILE A 130 ASP A 134 E 2 ARG A 137 ? GLU A 142 ? ARG A 137 GLU A 142 E 3 LYS A 245 ? PHE A 249 ? LYS A 245 PHE A 249 E 4 GLU A 148 ? GLU A 154 ? GLU A 148 GLU A 154 E 5 ARG A 161 ? VAL A 167 ? ARG A 161 VAL A 167 F 1 PHE A 180 ? PHE A 182 ? PHE A 180 PHE A 182 F 2 LEU A 204 ? LEU A 206 ? LEU A 204 LEU A 206 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 6 ? N THR A 6 O LEU A 115 ? O LEU A 115 B 1 2 N LEU A 11 ? N LEU A 11 O ILE A 28 ? O ILE A 28 B 2 3 N ILE A 27 ? N ILE A 27 O GLU A 90 ? O GLU A 90 B 3 4 O ILE A 89 ? O ILE A 89 N ARG A 38 ? N ARG A 38 B 4 5 N PHE A 39 ? N PHE A 39 O ILE A 46 ? O ILE A 46 C 1 2 N VAL A 54 ? N VAL A 54 O ASP A 61 ? O ASP A 61 C 2 3 N LEU A 62 ? N LEU A 62 O ILE A 69 ? O ILE A 69 D 1 2 N PHE A 124 ? N PHE A 124 O LYS A 243 ? O LYS A 243 E 1 2 N ASP A 134 ? N ASP A 134 O ARG A 137 ? O ARG A 137 E 2 3 N GLU A 142 ? N GLU A 142 O LYS A 245 ? O LYS A 245 E 3 4 O PHE A 246 ? O PHE A 246 N GLU A 148 ? N GLU A 148 E 4 5 N VAL A 149 ? N VAL A 149 O PHE A 166 ? O PHE A 166 F 1 2 N CYS A 181 ? N CYS A 181 O LEU A 206 ? O LEU A 206 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 319 ? 5 'BINDING SITE FOR RESIDUE ZN A 319' AC2 Software A TUX 320 ? 15 'BINDING SITE FOR RESIDUE TUX A 320' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 74 ? HIS A 74 . ? 1_555 ? 2 AC1 5 THR A 179 ? THR A 179 . ? 1_555 ? 3 AC1 5 HIS A 226 ? HIS A 226 . ? 1_555 ? 4 AC1 5 ASP A 230 ? ASP A 230 . ? 1_555 ? 5 AC1 5 TUX C . ? TUX A 320 . ? 1_555 ? 6 AC2 15 HIS A 58 ? HIS A 58 . ? 1_555 ? 7 AC2 15 SER A 59 ? SER A 59 . ? 1_555 ? 8 AC2 15 GLU A 73 ? GLU A 73 . ? 1_555 ? 9 AC2 15 HIS A 74 ? HIS A 74 . ? 1_555 ? 10 AC2 15 THR A 179 ? THR A 179 . ? 1_555 ? 11 AC2 15 PHE A 180 ? PHE A 180 . ? 1_555 ? 12 AC2 15 CYS A 181 ? CYS A 181 . ? 1_555 ? 13 AC2 15 GLU A 185 ? GLU A 185 . ? 1_555 ? 14 AC2 15 ILE A 186 ? ILE A 186 . ? 1_555 ? 15 AC2 15 ILE A 189 ? ILE A 189 . ? 1_555 ? 16 AC2 15 GLY A 195 ? GLY A 195 . ? 1_555 ? 17 AC2 15 GLY A 198 ? GLY A 198 . ? 1_555 ? 18 AC2 15 TYR A 212 ? TYR A 212 . ? 1_555 ? 19 AC2 15 LYS A 227 ? LYS A 227 . ? 1_555 ? 20 AC2 15 ZN B . ? ZN A 319 . ? 1_555 ? # _atom_sites.entry_id 1XXE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 PHE 180 180 180 PHE PHE A . n A 1 181 CYS 181 181 181 CYS CYS A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 TRP 184 184 184 TRP TRP A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 GLY 216 216 216 GLY GLY A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 TYR 219 219 219 TYR TYR A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 ASN 221 221 221 ASN ASN A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 HIS 226 226 226 HIS HIS A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 PHE 229 229 229 PHE PHE A . n A 1 230 ASP 230 230 230 ASP ASP A . n A 1 231 LEU 231 231 231 LEU LEU A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 LYS 243 243 243 LYS LYS A . n A 1 244 GLY 244 244 244 GLY GLY A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 PHE 246 246 246 PHE PHE A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 PHE 249 249 249 PHE PHE A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 HIS 253 253 253 HIS HIS A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 ASN 256 256 256 ASN ASN A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 LYS 258 258 258 LYS LYS A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 LYS 261 261 261 LYS LYS A . n A 1 262 GLU 262 262 262 GLU GLU A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 LYS 266 266 266 LYS LYS A . n A 1 267 GLN 267 267 267 GLN GLN A . n A 1 268 LYS 268 268 268 LYS LYS A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 THR 270 270 270 THR THR A . n A 1 271 ARG 271 271 ? ? ? A . n A 1 272 ASP 272 272 ? ? ? A . n A 1 273 LEU 273 273 ? ? ? A . n A 1 274 PRO 274 274 ? ? ? A . n A 1 275 HIS 275 275 ? ? ? A . n A 1 276 LEU 276 276 ? ? ? A . n A 1 277 PRO 277 277 ? ? ? A . n A 1 278 SER 278 278 ? ? ? A . n A 1 279 VAL 279 279 ? ? ? A . n A 1 280 GLN 280 280 ? ? ? A . n A 1 281 ALA 281 281 ? ? ? A . n A 1 282 LEU 282 282 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 319 319 ZN ZN A . C 3 TUX 1 320 320 TUX TUX A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 74 ? A HIS 74 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 NE2 ? A HIS 226 ? A HIS 226 ? 1_555 76.1 ? 2 NE2 ? A HIS 74 ? A HIS 74 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 OD2 ? A ASP 230 ? A ASP 230 ? 1_555 81.1 ? 3 NE2 ? A HIS 226 ? A HIS 226 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 OD2 ? A ASP 230 ? A ASP 230 ? 1_555 85.5 ? 4 NE2 ? A HIS 74 ? A HIS 74 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 OYH ? C TUX . ? A TUX 320 ? 1_555 104.8 ? 5 NE2 ? A HIS 226 ? A HIS 226 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 OYH ? C TUX . ? A TUX 320 ? 1_555 116.1 ? 6 OD2 ? A ASP 230 ? A ASP 230 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 OYH ? C TUX . ? A TUX 320 ? 1_555 158.3 ? 7 NE2 ? A HIS 74 ? A HIS 74 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 OXH ? C TUX . ? A TUX 320 ? 1_555 81.0 ? 8 NE2 ? A HIS 226 ? A HIS 226 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 OXH ? C TUX . ? A TUX 320 ? 1_555 155.0 ? 9 OD2 ? A ASP 230 ? A ASP 230 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 OXH ? C TUX . ? A TUX 320 ? 1_555 100.8 ? 10 OYH ? C TUX . ? A TUX 320 ? 1_555 ZN ? B ZN . ? A ZN 319 ? 1_555 OXH ? C TUX . ? A TUX 320 ? 1_555 60.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-23 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HIS 50 ? ? H A VAL 53 ? ? 1.44 2 1 OD1 A ASN 221 ? ? HH21 A ARG 225 ? ? 1.52 3 1 OE2 A GLU 168 ? ? HZ1 A LYS 243 ? ? 1.52 4 1 H A LEU 147 ? ? OE2 A GLU 168 ? ? 1.55 5 2 H A THR 35 ? ? OD1 A ASN 86 ? ? 1.38 6 2 HZ2 A LYS 41 ? ? O A GLY 93 ? ? 1.40 7 2 O A HIS 50 ? ? H A VAL 53 ? ? 1.42 8 2 OD1 A ASN 157 ? ? H A LEU 159 ? ? 1.43 9 2 OE2 A GLU 4 ? ? H A GLY 34 ? ? 1.45 10 2 H A GLU 4 ? ? O A ARG 119 ? ? 1.49 11 3 HD21 A ASN 86 ? ? HE22 A GLN 117 ? ? 1.22 12 3 O A HIS 50 ? ? H A VAL 53 ? ? 1.42 13 3 OD2 A ASP 100 ? ? HG A SER 102 ? ? 1.56 14 3 H A GLU 4 ? ? O A ARG 119 ? ? 1.58 15 4 HD21 A ASN 221 ? ? HE A ARG 225 ? ? 1.23 16 4 HG1 A THR 179 ? ? OYH A TUX 320 ? ? 1.39 17 4 O A HIS 50 ? ? H A VAL 53 ? ? 1.40 18 4 OE2 A GLU 33 ? ? HE21 A GLN 117 ? ? 1.45 19 4 O A TYR 236 ? ? H A GLY 239 ? ? 1.53 20 4 H A GLU 4 ? ? O A ARG 119 ? ? 1.60 21 5 H A GLY 36 ? ? HD21 A ASN 86 ? ? 1.21 22 5 O A PHE 180 ? ? HOG4 A TUX 320 ? ? 1.44 23 5 O A HIS 50 ? ? H A VAL 53 ? ? 1.46 24 5 O A TYR 236 ? ? H A GLY 239 ? ? 1.54 25 5 H A PHE 182 ? ? OE2 A GLU 185 ? ? 1.56 26 5 H A GLU 4 ? ? O A ARG 119 ? ? 1.58 27 6 H A THR 35 ? ? OD1 A ASN 86 ? ? 1.41 28 6 O A HIS 50 ? ? H A VAL 53 ? ? 1.44 29 6 OD1 A ASN 157 ? ? H A LEU 159 ? ? 1.46 30 6 OE1 A GLU 4 ? ? HD22 A ASN 86 ? ? 1.55 31 6 H A GLU 4 ? ? O A ARG 119 ? ? 1.57 32 7 O A HIS 50 ? ? H A VAL 53 ? ? 1.41 33 7 O A LYS 32 ? ? HG1 A THR 35 ? ? 1.44 34 7 H A GLU 4 ? ? O A ARG 119 ? ? 1.58 35 8 O A HIS 50 ? ? H A VAL 53 ? ? 1.42 36 8 H A GLU 4 ? ? O A ARG 119 ? ? 1.46 37 8 OE1 A GLU 4 ? ? H A GLY 34 ? ? 1.51 38 8 O A PHE 180 ? ? HOG4 A TUX 320 ? ? 1.53 39 8 O A ILE 18 ? ? H A GLY 197 ? ? 1.60 40 9 H A GLY 36 ? ? HD21 A ASN 86 ? ? 1.22 41 9 HZ2 A LYS 265 ? ? HZ1 A LYS 268 ? ? 1.26 42 9 O A GLY 193 ? ? HZ1 A LYS 196 ? ? 1.34 43 9 HE22 A GLN 162 ? ? O A GLU 220 ? ? 1.39 44 9 OD1 A ASN 157 ? ? H A LEU 159 ? ? 1.40 45 9 O A HIS 50 ? ? H A VAL 53 ? ? 1.43 46 9 H A LEU 147 ? ? OE2 A GLU 168 ? ? 1.48 47 9 H A GLU 4 ? ? O A ARG 119 ? ? 1.50 48 10 HG1 A THR 6 ? ? H A VAL 7 ? ? 1.29 49 10 HG1 A THR 179 ? ? OYH A TUX 320 ? ? 1.32 50 10 O A HIS 50 ? ? H A VAL 53 ? ? 1.44 51 10 H A HIS 19 ? ? OE2 A GLU 95 ? ? 1.50 52 10 O A ILE 18 ? ? H A GLY 197 ? ? 1.58 53 11 OD1 A ASN 157 ? ? H A LEU 159 ? ? 1.44 54 11 O A HIS 50 ? ? H A VAL 53 ? ? 1.50 55 11 H A THR 35 ? ? OD1 A ASN 86 ? ? 1.50 56 11 H A LEU 147 ? ? OE2 A GLU 168 ? ? 1.57 57 12 H A GLY 36 ? ? HD21 A ASN 86 ? ? 1.28 58 12 O A HIS 50 ? ? H A VAL 53 ? ? 1.40 59 12 H A ARG 218 ? ? OE1 A GLU 222 ? ? 1.45 60 12 OD1 A ASN 57 ? ? H A HIS 58 ? ? 1.46 61 12 H A GLY 169 ? ? OE2 A GLU 171 ? ? 1.50 62 12 H A GLU 4 ? ? O A ARG 119 ? ? 1.54 63 12 OE1 A GLU 4 ? ? H A GLY 34 ? ? 1.55 64 12 HZ3 A LYS 41 ? ? O A GLY 93 ? ? 1.57 65 12 O A GLU 173 ? ? HE A ARG 225 ? ? 1.57 66 13 H A GLU 4 ? ? O A ARG 119 ? ? 1.41 67 13 O A HIS 50 ? ? H A VAL 53 ? ? 1.43 68 13 OE1 A GLU 148 ? ? HZ3 A LYS 245 ? ? 1.43 69 13 OE1 A GLU 4 ? ? H A GLY 34 ? ? 1.46 70 13 H A LEU 147 ? ? OE2 A GLU 168 ? ? 1.53 71 13 OD1 A ASN 57 ? ? H A HIS 58 ? ? 1.60 72 13 OE2 A GLU 33 ? ? H A ASN 118 ? ? 1.60 73 14 HG1 A THR 85 ? ? H A ASN 86 ? ? 1.33 74 14 O A HIS 50 ? ? H A VAL 53 ? ? 1.45 75 14 O A GLY 169 ? ? HD21 A ASN 170 ? ? 1.53 76 15 HD21 A ASN 86 ? ? HE22 A GLN 117 ? ? 1.27 77 15 H A LEU 147 ? ? OE2 A GLU 168 ? ? 1.38 78 15 OD1 A ASN 157 ? ? H A LEU 159 ? ? 1.41 79 15 H A PHE 182 ? ? OE2 A GLU 185 ? ? 1.42 80 15 O A HIS 50 ? ? H A VAL 53 ? ? 1.44 81 15 H A GLU 4 ? ? O A ARG 119 ? ? 1.48 82 16 H A GLY 36 ? ? HD21 A ASN 86 ? ? 1.24 83 16 O A LYS 32 ? ? HG1 A THR 35 ? ? 1.34 84 16 O A HIS 50 ? ? H A VAL 53 ? ? 1.44 85 16 HG1 A THR 56 ? ? OG A SER 254 ? ? 1.52 86 17 H A THR 35 ? ? HD21 A ASN 86 ? ? 1.23 87 17 HG A SER 24 ? ? O A ILE 92 ? ? 1.34 88 17 O A HIS 50 ? ? H A VAL 53 ? ? 1.50 89 17 H A HIS 19 ? ? OE2 A GLU 95 ? ? 1.51 90 17 OD1 A ASN 57 ? ? H A HIS 58 ? ? 1.53 91 17 OE1 A GLU 4 ? ? H A GLY 34 ? ? 1.54 92 17 H A GLU 4 ? ? O A ARG 119 ? ? 1.55 93 17 H A LEU 147 ? ? OE2 A GLU 168 ? ? 1.56 94 17 OE2 A GLU 128 ? ? HZ2 A LYS 266 ? ? 1.56 95 17 H A GLY 207 ? ? O A LYS 210 ? ? 1.56 96 18 H A THR 35 ? ? OD1 A ASN 86 ? ? 1.39 97 18 O A HIS 50 ? ? H A VAL 53 ? ? 1.40 98 18 HG1 A THR 20 ? ? OE1 A GLU 95 ? ? 1.46 99 18 H A GLU 4 ? ? O A ARG 119 ? ? 1.54 100 18 O A TYR 236 ? ? H A GLY 239 ? ? 1.57 101 19 HE A ARG 137 ? ? O A GLY 251 ? ? 1.48 102 19 O A HIS 50 ? ? H A VAL 53 ? ? 1.49 103 19 OD1 A ASN 221 ? ? HH21 A ARG 225 ? ? 1.50 104 20 H A GLU 4 ? ? O A ARG 119 ? ? 1.40 105 20 HG1 A THR 60 ? ? OE1 A GLU 73 ? ? 1.41 106 20 O A HIS 50 ? ? H A VAL 53 ? ? 1.42 107 20 O A ILE 18 ? ? H A GLY 197 ? ? 1.59 108 21 HZ2 A LYS 41 ? ? O A ARG 68 ? ? 1.41 109 21 H A THR 35 ? ? OD1 A ASN 86 ? ? 1.52 110 21 HG1 A THR 71 ? ? OE2 A GLU 95 ? ? 1.53 111 21 O A HIS 50 ? ? H A VAL 53 ? ? 1.53 112 21 H A GLU 4 ? ? O A ARG 119 ? ? 1.54 113 21 H A GLY 207 ? ? O A LYS 210 ? ? 1.58 114 22 H A GLY 36 ? ? HD21 A ASN 86 ? ? 1.29 115 22 O A HIS 50 ? ? H A VAL 53 ? ? 1.41 116 22 OD1 A ASN 57 ? ? H A HIS 58 ? ? 1.59 117 22 O A TYR 236 ? ? H A GLY 239 ? ? 1.59 118 23 H A THR 35 ? ? OD1 A ASN 86 ? ? 1.39 119 23 O A HIS 50 ? ? H A VAL 53 ? ? 1.40 120 23 OD1 A ASN 157 ? ? H A LEU 159 ? ? 1.44 121 23 OD1 A ASN 221 ? ? HH21 A ARG 225 ? ? 1.49 122 23 H A GLU 4 ? ? O A ARG 119 ? ? 1.53 123 23 O A TYR 236 ? ? H A GLY 239 ? ? 1.60 124 24 HD1 A HIS 50 ? ? H A GLU 51 ? ? 1.30 125 24 H A GLY 36 ? ? HD21 A ASN 86 ? ? 1.33 126 24 O A LYS 32 ? ? HG1 A THR 35 ? ? 1.34 127 24 O A LEU 99 ? ? HD21 A ASN 202 ? ? 1.39 128 24 O A HIS 50 ? ? H A VAL 53 ? ? 1.52 129 24 OE1 A GLU 4 ? ? HG1 A THR 85 ? ? 1.56 130 24 O A GLN 267 ? ? H A LEU 269 ? ? 1.58 131 24 O A TYR 236 ? ? H A GLY 239 ? ? 1.60 132 25 H A THR 35 ? ? HD21 A ASN 86 ? ? 1.26 133 25 O A HIS 50 ? ? H A VAL 53 ? ? 1.43 134 25 OE1 A GLU 4 ? ? H A GLY 34 ? ? 1.45 135 25 O A LEU 99 ? ? HD21 A ASN 202 ? ? 1.48 136 25 O A LYS 32 ? ? HG1 A THR 35 ? ? 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 33 ? ? -47.68 152.20 2 1 ASN A 57 ? ? -166.68 -154.26 3 1 LEU A 99 ? ? 57.59 -126.13 4 1 GLN A 117 ? ? -108.29 -166.69 5 1 ASN A 118 ? ? -116.73 70.70 6 1 ASP A 134 ? ? -174.17 147.99 7 1 ASP A 209 ? ? -147.76 16.16 8 1 GLU A 220 ? ? -46.50 -16.24 9 2 ASN A 57 ? ? -166.63 -153.89 10 2 HIS A 58 ? ? -48.59 -11.40 11 2 THR A 71 ? ? 52.41 70.35 12 2 THR A 85 ? ? -104.28 -74.63 13 2 LEU A 99 ? ? 58.35 -113.49 14 2 GLN A 117 ? ? -102.66 -161.19 15 2 ASN A 157 ? ? -70.43 -167.97 16 2 ASP A 209 ? ? -149.96 10.39 17 2 GLU A 220 ? ? -45.47 -16.67 18 3 LYS A 41 ? ? -176.06 126.69 19 3 ASN A 57 ? ? -166.00 -154.32 20 3 HIS A 58 ? ? -48.32 -12.16 21 3 THR A 85 ? ? -106.34 -76.68 22 3 LEU A 99 ? ? 55.32 -105.68 23 3 SER A 102 ? ? -123.98 -166.78 24 3 GLU A 120 ? ? -47.88 167.40 25 3 ASN A 157 ? ? -70.15 -166.64 26 3 GLU A 220 ? ? -49.34 -10.15 27 3 ASN A 221 ? ? -143.11 35.95 28 4 LYS A 41 ? ? -170.70 143.75 29 4 GLU A 51 ? ? -45.26 -15.62 30 4 ASN A 57 ? ? -166.47 -154.71 31 4 HIS A 58 ? ? -48.03 -11.95 32 4 GLU A 83 ? ? 63.41 60.72 33 4 LEU A 99 ? ? 55.24 -111.72 34 4 SER A 102 ? ? -109.93 -166.78 35 4 GLN A 117 ? ? -103.86 -163.03 36 4 ASP A 134 ? ? -175.26 137.93 37 4 ASN A 157 ? ? -73.74 -169.40 38 4 ASP A 209 ? ? -152.56 11.44 39 4 LEU A 269 ? ? -57.36 -84.39 40 5 LYS A 41 ? ? -170.00 139.46 41 5 GLU A 51 ? ? -45.55 -16.33 42 5 ASN A 57 ? ? -166.07 -154.30 43 5 HIS A 58 ? ? -47.81 -12.10 44 5 LEU A 99 ? ? 57.06 -110.87 45 5 SER A 102 ? ? -119.04 -168.84 46 5 ASN A 113 ? ? -144.37 32.18 47 5 GLN A 117 ? ? -105.41 -162.36 48 5 GLU A 135 ? ? 56.61 19.74 49 5 ASN A 157 ? ? -76.35 -169.94 50 5 ASP A 209 ? ? -150.49 10.12 51 6 LYS A 41 ? ? -172.35 138.24 52 6 GLU A 51 ? ? -46.56 -16.08 53 6 ASN A 57 ? ? -166.67 -153.60 54 6 HIS A 58 ? ? -44.85 -16.04 55 6 THR A 85 ? ? -107.47 -76.41 56 6 LEU A 99 ? ? 54.77 -116.65 57 6 GLN A 117 ? ? -108.85 -168.23 58 6 ASN A 118 ? ? -119.74 69.94 59 6 ARG A 119 ? ? -170.21 122.04 60 6 ASP A 134 ? ? -165.92 110.22 61 6 ASP A 209 ? ? -155.13 12.74 62 6 LEU A 269 ? ? -62.23 -83.93 63 7 ASN A 57 ? ? -166.66 -153.64 64 7 HIS A 58 ? ? -48.31 -11.13 65 7 THR A 85 ? ? -104.10 -77.47 66 7 LEU A 99 ? ? 57.62 -116.14 67 7 SER A 102 ? ? -117.09 -169.26 68 7 GLN A 117 ? ? -106.48 -162.67 69 7 ASP A 134 ? ? -168.56 114.96 70 7 ASN A 157 ? ? -73.40 -166.78 71 7 ASN A 202 ? ? -150.22 16.35 72 7 ASP A 209 ? ? -153.25 12.60 73 7 GLU A 220 ? ? -46.50 -12.33 74 8 LYS A 41 ? ? -176.50 145.94 75 8 ASN A 57 ? ? -166.38 -154.20 76 8 HIS A 58 ? ? -48.05 -11.65 77 8 GLU A 83 ? ? 62.80 63.52 78 8 LEU A 99 ? ? 54.92 -155.52 79 8 ASP A 100 ? ? -54.95 -1.64 80 8 SER A 102 ? ? -112.09 -168.53 81 8 GLN A 117 ? ? -106.00 -163.77 82 8 ASP A 209 ? ? -151.01 10.80 83 8 LEU A 238 ? ? -55.02 -7.83 84 8 LYS A 268 ? ? -73.60 -79.41 85 9 LYS A 41 ? ? -172.54 138.92 86 9 ASN A 57 ? ? -166.39 -154.44 87 9 HIS A 58 ? ? -48.87 -10.90 88 9 LEU A 99 ? ? 54.89 -112.78 89 9 SER A 102 ? ? -113.10 -168.89 90 9 GLN A 117 ? ? -107.01 -166.15 91 9 ASN A 118 ? ? -118.73 72.98 92 9 ASP A 134 ? ? -165.52 110.98 93 9 ASN A 157 ? ? -69.65 -167.09 94 9 ASN A 202 ? ? -141.26 13.85 95 9 ASP A 209 ? ? -152.59 13.89 96 9 GLU A 220 ? ? -48.75 -12.23 97 9 LEU A 269 ? ? -107.02 -84.05 98 10 LYS A 41 ? ? -172.30 143.27 99 10 GLU A 51 ? ? -44.79 -16.26 100 10 ASN A 57 ? ? -166.61 -153.63 101 10 HIS A 58 ? ? -46.11 -15.08 102 10 LEU A 99 ? ? 55.42 -110.59 103 10 SER A 102 ? ? -114.49 -169.67 104 10 GLN A 117 ? ? -108.86 -161.45 105 10 ASN A 157 ? ? -73.45 -168.03 106 10 ASP A 209 ? ? -146.19 19.02 107 11 LYS A 41 ? ? -170.96 140.91 108 11 GLU A 51 ? ? -47.54 -16.19 109 11 ASN A 57 ? ? -166.84 -153.95 110 11 HIS A 58 ? ? -46.59 -13.02 111 11 GLU A 83 ? ? 63.37 63.32 112 11 LEU A 99 ? ? 52.80 -109.78 113 11 GLN A 117 ? ? -109.44 -169.06 114 11 GLU A 135 ? ? 59.09 19.50 115 11 ASN A 157 ? ? -73.90 -168.57 116 11 ASP A 209 ? ? -141.88 11.56 117 11 GLU A 220 ? ? -48.03 -12.86 118 12 LYS A 41 ? ? -174.59 138.22 119 12 GLU A 51 ? ? -44.06 -16.58 120 12 ASN A 57 ? ? -166.36 -154.28 121 12 HIS A 58 ? ? -47.96 -12.59 122 12 THR A 71 ? ? 47.38 72.86 123 12 LEU A 99 ? ? 54.89 -113.73 124 12 SER A 102 ? ? -112.30 -169.18 125 12 GLN A 117 ? ? -108.93 -162.65 126 12 ASN A 157 ? ? -73.12 -167.50 127 12 ASP A 209 ? ? -153.66 12.69 128 12 GLU A 220 ? ? -51.22 -9.55 129 13 GLU A 33 ? ? -49.50 150.34 130 13 LYS A 41 ? ? -173.78 131.26 131 13 GLU A 51 ? ? -47.00 -15.79 132 13 ASN A 57 ? ? -166.87 -153.94 133 13 HIS A 58 ? ? -46.92 -13.23 134 13 GLU A 83 ? ? 64.03 60.48 135 13 LEU A 99 ? ? 53.66 -113.91 136 13 SER A 102 ? ? -116.69 -167.75 137 13 GLN A 117 ? ? -100.17 -161.45 138 13 ASN A 157 ? ? -76.24 -167.17 139 13 ASN A 202 ? ? -142.48 11.92 140 13 LYS A 268 ? ? -47.15 -15.57 141 14 ASN A 57 ? ? -166.52 -154.58 142 14 THR A 85 ? ? -101.88 -76.61 143 14 LEU A 99 ? ? 56.77 -110.53 144 14 GLN A 117 ? ? -111.23 -166.53 145 14 ASN A 118 ? ? -116.66 70.83 146 14 ASN A 157 ? ? -75.06 -169.77 147 14 ASP A 209 ? ? -149.41 17.47 148 14 LYS A 268 ? ? -99.51 -71.57 149 15 LYS A 41 ? ? -175.48 146.87 150 15 GLU A 51 ? ? -46.77 -17.28 151 15 ASN A 57 ? ? -167.16 -152.98 152 15 HIS A 58 ? ? -44.37 -16.76 153 15 THR A 71 ? ? 55.05 71.60 154 15 GLU A 83 ? ? 62.69 63.00 155 15 THR A 85 ? ? -107.63 -78.21 156 15 LEU A 99 ? ? 47.57 -116.19 157 15 GLN A 117 ? ? -107.75 -157.50 158 15 GLU A 135 ? ? 57.71 19.93 159 15 PRO A 143 ? ? -46.39 152.48 160 15 ASN A 157 ? ? -76.93 -167.64 161 15 ASN A 202 ? ? -143.54 14.42 162 15 ASP A 209 ? ? -150.70 13.31 163 15 ARG A 250 ? ? 42.83 16.09 164 15 GLN A 267 ? ? -62.45 1.09 165 15 LYS A 268 ? ? -83.12 33.50 166 16 LYS A 41 ? ? -173.40 138.11 167 16 GLU A 51 ? ? -44.90 -16.25 168 16 ASN A 57 ? ? -166.79 -154.35 169 16 HIS A 58 ? ? -48.08 -12.59 170 16 LEU A 99 ? ? 55.12 -104.32 171 16 SER A 102 ? ? -123.50 -166.23 172 16 GLU A 120 ? ? -48.12 167.19 173 16 ASN A 157 ? ? -74.47 -167.25 174 16 ASN A 202 ? ? -153.09 18.45 175 16 ASP A 209 ? ? -155.07 14.48 176 16 LEU A 238 ? ? -53.30 -9.94 177 17 LYS A 41 ? ? -172.96 135.79 178 17 GLU A 51 ? ? -48.39 -17.16 179 17 ASN A 57 ? ? -167.58 -152.41 180 17 HIS A 58 ? ? -44.13 -15.75 181 17 THR A 71 ? ? 53.57 70.04 182 17 LEU A 99 ? ? 55.21 -109.99 183 17 SER A 102 ? ? -116.46 -169.30 184 17 GLN A 117 ? ? -107.27 -160.57 185 17 ASN A 157 ? ? -71.32 -167.77 186 17 ASP A 209 ? ? -150.97 12.61 187 17 ASN A 221 ? ? -143.73 36.69 188 18 LYS A 41 ? ? -174.02 147.33 189 18 GLU A 51 ? ? -44.00 -16.06 190 18 ASN A 57 ? ? -166.61 -153.42 191 18 HIS A 58 ? ? -47.47 -11.46 192 18 GLU A 83 ? ? 63.14 61.88 193 18 LEU A 99 ? ? 55.33 -116.07 194 18 SER A 102 ? ? -108.33 -169.72 195 18 GLN A 117 ? ? -109.08 -167.09 196 18 ASN A 118 ? ? -118.75 69.05 197 18 ASP A 134 ? ? 178.03 153.32 198 18 ASN A 157 ? ? -66.18 -167.01 199 18 ASN A 202 ? ? -141.12 12.83 200 18 ASP A 209 ? ? -147.34 11.97 201 18 GLU A 220 ? ? -48.09 -13.98 202 19 GLU A 51 ? ? -48.28 -16.14 203 19 ASN A 57 ? ? -166.36 -153.34 204 19 HIS A 58 ? ? -46.69 -13.02 205 19 THR A 71 ? ? 56.53 70.88 206 19 LEU A 99 ? ? 54.84 -118.36 207 19 SER A 102 ? ? -115.51 -169.47 208 19 GLN A 117 ? ? -112.39 -163.82 209 19 ASN A 118 ? ? -118.10 69.47 210 19 ASP A 134 ? ? -172.10 142.69 211 19 ASN A 157 ? ? -66.18 -175.23 212 19 ASN A 202 ? ? -145.12 13.98 213 19 ASP A 209 ? ? -150.87 13.32 214 19 GLU A 220 ? ? -49.66 -11.68 215 19 ASN A 221 ? ? -141.88 43.49 216 19 LEU A 269 ? ? -79.77 -75.10 217 20 LYS A 41 ? ? -170.26 137.03 218 20 GLU A 51 ? ? -44.90 -15.99 219 20 ASN A 57 ? ? -166.81 -153.91 220 20 HIS A 58 ? ? -47.07 -12.81 221 20 THR A 85 ? ? -101.98 -75.41 222 20 LEU A 99 ? ? 56.18 -116.00 223 20 GLN A 117 ? ? -101.27 -161.65 224 20 ASP A 134 ? ? 179.76 154.42 225 20 LEU A 269 ? ? -57.97 -9.37 226 21 GLU A 33 ? ? -48.32 150.89 227 21 ASN A 57 ? ? -167.29 -154.00 228 21 HIS A 58 ? ? -45.53 -15.69 229 21 THR A 85 ? ? -105.17 -77.01 230 21 LEU A 99 ? ? 55.43 -119.17 231 21 GLN A 117 ? ? -102.63 -166.45 232 21 GLU A 135 ? ? 56.63 18.74 233 21 ASN A 157 ? ? -68.44 -167.87 234 21 ASN A 170 ? ? -141.48 28.67 235 21 ASN A 202 ? ? -151.18 17.67 236 21 GLU A 220 ? ? -45.52 -13.89 237 21 GLN A 267 ? ? -40.07 -70.40 238 22 GLU A 51 ? ? -46.55 -15.81 239 22 ASN A 57 ? ? -167.06 -152.76 240 22 HIS A 58 ? ? -44.21 -16.16 241 22 THR A 71 ? ? 53.87 71.60 242 22 THR A 85 ? ? -107.04 -76.60 243 22 LEU A 99 ? ? 55.72 -118.08 244 22 ASN A 113 ? ? -149.46 30.68 245 22 GLU A 120 ? ? -47.30 167.26 246 22 ASP A 122 ? ? -60.94 71.28 247 22 ASN A 157 ? ? -66.79 -170.74 248 22 ASP A 209 ? ? -145.61 10.32 249 22 LEU A 269 ? ? -94.37 -75.12 250 23 ASN A 57 ? ? -166.87 -153.22 251 23 HIS A 58 ? ? -45.64 -15.54 252 23 THR A 71 ? ? 54.75 70.22 253 23 GLU A 83 ? ? 60.14 63.46 254 23 LEU A 99 ? ? 54.99 -121.91 255 23 GLN A 117 ? ? -105.09 -162.41 256 23 ASP A 209 ? ? -152.67 11.92 257 23 PRO A 214 ? ? -54.45 -8.49 258 23 LEU A 269 ? ? -45.64 -13.70 259 24 LYS A 41 ? ? -173.75 133.48 260 24 GLU A 51 ? ? -48.77 -16.63 261 24 ASN A 57 ? ? -166.98 -154.04 262 24 HIS A 58 ? ? -47.04 -13.71 263 24 THR A 71 ? ? 53.94 71.68 264 24 LEU A 99 ? ? 56.48 -108.77 265 24 GLN A 117 ? ? -109.56 -168.45 266 24 ASN A 157 ? ? -70.34 -167.95 267 24 GLU A 172 ? ? -58.55 -9.97 268 24 ASP A 209 ? ? -149.71 14.77 269 24 ASN A 221 ? ? -141.87 38.03 270 24 LYS A 268 ? ? -66.05 33.65 271 25 LYS A 41 ? ? -170.86 138.76 272 25 ASN A 57 ? ? -167.10 -153.25 273 25 HIS A 58 ? ? -45.55 -14.59 274 25 LEU A 99 ? ? 54.65 -111.40 275 25 SER A 102 ? ? -129.27 -167.30 276 25 GLN A 117 ? ? -112.66 -166.42 277 25 ASN A 157 ? ? -66.48 -172.39 278 25 GLU A 172 ? ? -54.34 -9.41 279 25 ASP A 209 ? ? -151.32 13.21 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A ARG 271 ? A ARG 271 4 1 Y 1 A ASP 272 ? A ASP 272 5 1 Y 1 A LEU 273 ? A LEU 273 6 1 Y 1 A PRO 274 ? A PRO 274 7 1 Y 1 A HIS 275 ? A HIS 275 8 1 Y 1 A LEU 276 ? A LEU 276 9 1 Y 1 A PRO 277 ? A PRO 277 10 1 Y 1 A SER 278 ? A SER 278 11 1 Y 1 A VAL 279 ? A VAL 279 12 1 Y 1 A GLN 280 ? A GLN 280 13 1 Y 1 A ALA 281 ? A ALA 281 14 1 Y 1 A LEU 282 ? A LEU 282 15 2 Y 1 A MET 1 ? A MET 1 16 2 Y 1 A GLY 2 ? A GLY 2 17 2 Y 1 A ARG 271 ? A ARG 271 18 2 Y 1 A ASP 272 ? A ASP 272 19 2 Y 1 A LEU 273 ? A LEU 273 20 2 Y 1 A PRO 274 ? A PRO 274 21 2 Y 1 A HIS 275 ? A HIS 275 22 2 Y 1 A LEU 276 ? A LEU 276 23 2 Y 1 A PRO 277 ? A PRO 277 24 2 Y 1 A SER 278 ? A SER 278 25 2 Y 1 A VAL 279 ? A VAL 279 26 2 Y 1 A GLN 280 ? A GLN 280 27 2 Y 1 A ALA 281 ? A ALA 281 28 2 Y 1 A LEU 282 ? A LEU 282 29 3 Y 1 A MET 1 ? A MET 1 30 3 Y 1 A GLY 2 ? A GLY 2 31 3 Y 1 A ARG 271 ? A ARG 271 32 3 Y 1 A ASP 272 ? A ASP 272 33 3 Y 1 A LEU 273 ? A LEU 273 34 3 Y 1 A PRO 274 ? A PRO 274 35 3 Y 1 A HIS 275 ? A HIS 275 36 3 Y 1 A LEU 276 ? A LEU 276 37 3 Y 1 A PRO 277 ? A PRO 277 38 3 Y 1 A SER 278 ? A SER 278 39 3 Y 1 A VAL 279 ? A VAL 279 40 3 Y 1 A GLN 280 ? A GLN 280 41 3 Y 1 A ALA 281 ? A ALA 281 42 3 Y 1 A LEU 282 ? A LEU 282 43 4 Y 1 A MET 1 ? A MET 1 44 4 Y 1 A GLY 2 ? A GLY 2 45 4 Y 1 A ARG 271 ? A ARG 271 46 4 Y 1 A ASP 272 ? A ASP 272 47 4 Y 1 A LEU 273 ? A LEU 273 48 4 Y 1 A PRO 274 ? A PRO 274 49 4 Y 1 A HIS 275 ? A HIS 275 50 4 Y 1 A LEU 276 ? A LEU 276 51 4 Y 1 A PRO 277 ? A PRO 277 52 4 Y 1 A SER 278 ? A SER 278 53 4 Y 1 A VAL 279 ? A VAL 279 54 4 Y 1 A GLN 280 ? A GLN 280 55 4 Y 1 A ALA 281 ? A ALA 281 56 4 Y 1 A LEU 282 ? A LEU 282 57 5 Y 1 A MET 1 ? A MET 1 58 5 Y 1 A GLY 2 ? A GLY 2 59 5 Y 1 A ARG 271 ? A ARG 271 60 5 Y 1 A ASP 272 ? A ASP 272 61 5 Y 1 A LEU 273 ? A LEU 273 62 5 Y 1 A PRO 274 ? A PRO 274 63 5 Y 1 A HIS 275 ? A HIS 275 64 5 Y 1 A LEU 276 ? A LEU 276 65 5 Y 1 A PRO 277 ? A PRO 277 66 5 Y 1 A SER 278 ? A SER 278 67 5 Y 1 A VAL 279 ? A VAL 279 68 5 Y 1 A GLN 280 ? A GLN 280 69 5 Y 1 A ALA 281 ? A ALA 281 70 5 Y 1 A LEU 282 ? A LEU 282 71 6 Y 1 A MET 1 ? A MET 1 72 6 Y 1 A GLY 2 ? A GLY 2 73 6 Y 1 A ARG 271 ? A ARG 271 74 6 Y 1 A ASP 272 ? A ASP 272 75 6 Y 1 A LEU 273 ? A LEU 273 76 6 Y 1 A PRO 274 ? A PRO 274 77 6 Y 1 A HIS 275 ? A HIS 275 78 6 Y 1 A LEU 276 ? A LEU 276 79 6 Y 1 A PRO 277 ? A PRO 277 80 6 Y 1 A SER 278 ? A SER 278 81 6 Y 1 A VAL 279 ? A VAL 279 82 6 Y 1 A GLN 280 ? A GLN 280 83 6 Y 1 A ALA 281 ? A ALA 281 84 6 Y 1 A LEU 282 ? A LEU 282 85 7 Y 1 A MET 1 ? A MET 1 86 7 Y 1 A GLY 2 ? A GLY 2 87 7 Y 1 A ARG 271 ? A ARG 271 88 7 Y 1 A ASP 272 ? A ASP 272 89 7 Y 1 A LEU 273 ? A LEU 273 90 7 Y 1 A PRO 274 ? A PRO 274 91 7 Y 1 A HIS 275 ? A HIS 275 92 7 Y 1 A LEU 276 ? A LEU 276 93 7 Y 1 A PRO 277 ? A PRO 277 94 7 Y 1 A SER 278 ? A SER 278 95 7 Y 1 A VAL 279 ? A VAL 279 96 7 Y 1 A GLN 280 ? A GLN 280 97 7 Y 1 A ALA 281 ? A ALA 281 98 7 Y 1 A LEU 282 ? A LEU 282 99 8 Y 1 A MET 1 ? A MET 1 100 8 Y 1 A GLY 2 ? A GLY 2 101 8 Y 1 A ARG 271 ? A ARG 271 102 8 Y 1 A ASP 272 ? A ASP 272 103 8 Y 1 A LEU 273 ? A LEU 273 104 8 Y 1 A PRO 274 ? A PRO 274 105 8 Y 1 A HIS 275 ? A HIS 275 106 8 Y 1 A LEU 276 ? A LEU 276 107 8 Y 1 A PRO 277 ? A PRO 277 108 8 Y 1 A SER 278 ? A SER 278 109 8 Y 1 A VAL 279 ? A VAL 279 110 8 Y 1 A GLN 280 ? A GLN 280 111 8 Y 1 A ALA 281 ? A ALA 281 112 8 Y 1 A LEU 282 ? A LEU 282 113 9 Y 1 A MET 1 ? A MET 1 114 9 Y 1 A GLY 2 ? A GLY 2 115 9 Y 1 A ARG 271 ? A ARG 271 116 9 Y 1 A ASP 272 ? A ASP 272 117 9 Y 1 A LEU 273 ? A LEU 273 118 9 Y 1 A PRO 274 ? A PRO 274 119 9 Y 1 A HIS 275 ? A HIS 275 120 9 Y 1 A LEU 276 ? A LEU 276 121 9 Y 1 A PRO 277 ? A PRO 277 122 9 Y 1 A SER 278 ? A SER 278 123 9 Y 1 A VAL 279 ? A VAL 279 124 9 Y 1 A GLN 280 ? A GLN 280 125 9 Y 1 A ALA 281 ? A ALA 281 126 9 Y 1 A LEU 282 ? A LEU 282 127 10 Y 1 A MET 1 ? A MET 1 128 10 Y 1 A GLY 2 ? A GLY 2 129 10 Y 1 A ARG 271 ? A ARG 271 130 10 Y 1 A ASP 272 ? A ASP 272 131 10 Y 1 A LEU 273 ? A LEU 273 132 10 Y 1 A PRO 274 ? A PRO 274 133 10 Y 1 A HIS 275 ? A HIS 275 134 10 Y 1 A LEU 276 ? A LEU 276 135 10 Y 1 A PRO 277 ? A PRO 277 136 10 Y 1 A SER 278 ? A SER 278 137 10 Y 1 A VAL 279 ? A VAL 279 138 10 Y 1 A GLN 280 ? A GLN 280 139 10 Y 1 A ALA 281 ? A ALA 281 140 10 Y 1 A LEU 282 ? A LEU 282 141 11 Y 1 A MET 1 ? A MET 1 142 11 Y 1 A GLY 2 ? A GLY 2 143 11 Y 1 A ARG 271 ? A ARG 271 144 11 Y 1 A ASP 272 ? A ASP 272 145 11 Y 1 A LEU 273 ? A LEU 273 146 11 Y 1 A PRO 274 ? A PRO 274 147 11 Y 1 A HIS 275 ? A HIS 275 148 11 Y 1 A LEU 276 ? A LEU 276 149 11 Y 1 A PRO 277 ? A PRO 277 150 11 Y 1 A SER 278 ? A SER 278 151 11 Y 1 A VAL 279 ? A VAL 279 152 11 Y 1 A GLN 280 ? A GLN 280 153 11 Y 1 A ALA 281 ? A ALA 281 154 11 Y 1 A LEU 282 ? A LEU 282 155 12 Y 1 A MET 1 ? A MET 1 156 12 Y 1 A GLY 2 ? A GLY 2 157 12 Y 1 A ARG 271 ? A ARG 271 158 12 Y 1 A ASP 272 ? A ASP 272 159 12 Y 1 A LEU 273 ? A LEU 273 160 12 Y 1 A PRO 274 ? A PRO 274 161 12 Y 1 A HIS 275 ? A HIS 275 162 12 Y 1 A LEU 276 ? A LEU 276 163 12 Y 1 A PRO 277 ? A PRO 277 164 12 Y 1 A SER 278 ? A SER 278 165 12 Y 1 A VAL 279 ? A VAL 279 166 12 Y 1 A GLN 280 ? A GLN 280 167 12 Y 1 A ALA 281 ? A ALA 281 168 12 Y 1 A LEU 282 ? A LEU 282 169 13 Y 1 A MET 1 ? A MET 1 170 13 Y 1 A GLY 2 ? A GLY 2 171 13 Y 1 A ARG 271 ? A ARG 271 172 13 Y 1 A ASP 272 ? A ASP 272 173 13 Y 1 A LEU 273 ? A LEU 273 174 13 Y 1 A PRO 274 ? A PRO 274 175 13 Y 1 A HIS 275 ? A HIS 275 176 13 Y 1 A LEU 276 ? A LEU 276 177 13 Y 1 A PRO 277 ? A PRO 277 178 13 Y 1 A SER 278 ? A SER 278 179 13 Y 1 A VAL 279 ? A VAL 279 180 13 Y 1 A GLN 280 ? A GLN 280 181 13 Y 1 A ALA 281 ? A ALA 281 182 13 Y 1 A LEU 282 ? A LEU 282 183 14 Y 1 A MET 1 ? A MET 1 184 14 Y 1 A GLY 2 ? A GLY 2 185 14 Y 1 A ARG 271 ? A ARG 271 186 14 Y 1 A ASP 272 ? A ASP 272 187 14 Y 1 A LEU 273 ? A LEU 273 188 14 Y 1 A PRO 274 ? A PRO 274 189 14 Y 1 A HIS 275 ? A HIS 275 190 14 Y 1 A LEU 276 ? A LEU 276 191 14 Y 1 A PRO 277 ? A PRO 277 192 14 Y 1 A SER 278 ? A SER 278 193 14 Y 1 A VAL 279 ? A VAL 279 194 14 Y 1 A GLN 280 ? A GLN 280 195 14 Y 1 A ALA 281 ? A ALA 281 196 14 Y 1 A LEU 282 ? A LEU 282 197 15 Y 1 A MET 1 ? A MET 1 198 15 Y 1 A GLY 2 ? A GLY 2 199 15 Y 1 A ARG 271 ? A ARG 271 200 15 Y 1 A ASP 272 ? A ASP 272 201 15 Y 1 A LEU 273 ? A LEU 273 202 15 Y 1 A PRO 274 ? A PRO 274 203 15 Y 1 A HIS 275 ? A HIS 275 204 15 Y 1 A LEU 276 ? A LEU 276 205 15 Y 1 A PRO 277 ? A PRO 277 206 15 Y 1 A SER 278 ? A SER 278 207 15 Y 1 A VAL 279 ? A VAL 279 208 15 Y 1 A GLN 280 ? A GLN 280 209 15 Y 1 A ALA 281 ? A ALA 281 210 15 Y 1 A LEU 282 ? A LEU 282 211 16 Y 1 A MET 1 ? A MET 1 212 16 Y 1 A GLY 2 ? A GLY 2 213 16 Y 1 A ARG 271 ? A ARG 271 214 16 Y 1 A ASP 272 ? A ASP 272 215 16 Y 1 A LEU 273 ? A LEU 273 216 16 Y 1 A PRO 274 ? A PRO 274 217 16 Y 1 A HIS 275 ? A HIS 275 218 16 Y 1 A LEU 276 ? A LEU 276 219 16 Y 1 A PRO 277 ? A PRO 277 220 16 Y 1 A SER 278 ? A SER 278 221 16 Y 1 A VAL 279 ? A VAL 279 222 16 Y 1 A GLN 280 ? A GLN 280 223 16 Y 1 A ALA 281 ? A ALA 281 224 16 Y 1 A LEU 282 ? A LEU 282 225 17 Y 1 A MET 1 ? A MET 1 226 17 Y 1 A GLY 2 ? A GLY 2 227 17 Y 1 A ARG 271 ? A ARG 271 228 17 Y 1 A ASP 272 ? A ASP 272 229 17 Y 1 A LEU 273 ? A LEU 273 230 17 Y 1 A PRO 274 ? A PRO 274 231 17 Y 1 A HIS 275 ? A HIS 275 232 17 Y 1 A LEU 276 ? A LEU 276 233 17 Y 1 A PRO 277 ? A PRO 277 234 17 Y 1 A SER 278 ? A SER 278 235 17 Y 1 A VAL 279 ? A VAL 279 236 17 Y 1 A GLN 280 ? A GLN 280 237 17 Y 1 A ALA 281 ? A ALA 281 238 17 Y 1 A LEU 282 ? A LEU 282 239 18 Y 1 A MET 1 ? A MET 1 240 18 Y 1 A GLY 2 ? A GLY 2 241 18 Y 1 A ARG 271 ? A ARG 271 242 18 Y 1 A ASP 272 ? A ASP 272 243 18 Y 1 A LEU 273 ? A LEU 273 244 18 Y 1 A PRO 274 ? A PRO 274 245 18 Y 1 A HIS 275 ? A HIS 275 246 18 Y 1 A LEU 276 ? A LEU 276 247 18 Y 1 A PRO 277 ? A PRO 277 248 18 Y 1 A SER 278 ? A SER 278 249 18 Y 1 A VAL 279 ? A VAL 279 250 18 Y 1 A GLN 280 ? A GLN 280 251 18 Y 1 A ALA 281 ? A ALA 281 252 18 Y 1 A LEU 282 ? A LEU 282 253 19 Y 1 A MET 1 ? A MET 1 254 19 Y 1 A GLY 2 ? A GLY 2 255 19 Y 1 A ARG 271 ? A ARG 271 256 19 Y 1 A ASP 272 ? A ASP 272 257 19 Y 1 A LEU 273 ? A LEU 273 258 19 Y 1 A PRO 274 ? A PRO 274 259 19 Y 1 A HIS 275 ? A HIS 275 260 19 Y 1 A LEU 276 ? A LEU 276 261 19 Y 1 A PRO 277 ? A PRO 277 262 19 Y 1 A SER 278 ? A SER 278 263 19 Y 1 A VAL 279 ? A VAL 279 264 19 Y 1 A GLN 280 ? A GLN 280 265 19 Y 1 A ALA 281 ? A ALA 281 266 19 Y 1 A LEU 282 ? A LEU 282 267 20 Y 1 A MET 1 ? A MET 1 268 20 Y 1 A GLY 2 ? A GLY 2 269 20 Y 1 A ARG 271 ? A ARG 271 270 20 Y 1 A ASP 272 ? A ASP 272 271 20 Y 1 A LEU 273 ? A LEU 273 272 20 Y 1 A PRO 274 ? A PRO 274 273 20 Y 1 A HIS 275 ? A HIS 275 274 20 Y 1 A LEU 276 ? A LEU 276 275 20 Y 1 A PRO 277 ? A PRO 277 276 20 Y 1 A SER 278 ? A SER 278 277 20 Y 1 A VAL 279 ? A VAL 279 278 20 Y 1 A GLN 280 ? A GLN 280 279 20 Y 1 A ALA 281 ? A ALA 281 280 20 Y 1 A LEU 282 ? A LEU 282 281 21 Y 1 A MET 1 ? A MET 1 282 21 Y 1 A GLY 2 ? A GLY 2 283 21 Y 1 A ARG 271 ? A ARG 271 284 21 Y 1 A ASP 272 ? A ASP 272 285 21 Y 1 A LEU 273 ? A LEU 273 286 21 Y 1 A PRO 274 ? A PRO 274 287 21 Y 1 A HIS 275 ? A HIS 275 288 21 Y 1 A LEU 276 ? A LEU 276 289 21 Y 1 A PRO 277 ? A PRO 277 290 21 Y 1 A SER 278 ? A SER 278 291 21 Y 1 A VAL 279 ? A VAL 279 292 21 Y 1 A GLN 280 ? A GLN 280 293 21 Y 1 A ALA 281 ? A ALA 281 294 21 Y 1 A LEU 282 ? A LEU 282 295 22 Y 1 A MET 1 ? A MET 1 296 22 Y 1 A GLY 2 ? A GLY 2 297 22 Y 1 A ARG 271 ? A ARG 271 298 22 Y 1 A ASP 272 ? A ASP 272 299 22 Y 1 A LEU 273 ? A LEU 273 300 22 Y 1 A PRO 274 ? A PRO 274 301 22 Y 1 A HIS 275 ? A HIS 275 302 22 Y 1 A LEU 276 ? A LEU 276 303 22 Y 1 A PRO 277 ? A PRO 277 304 22 Y 1 A SER 278 ? A SER 278 305 22 Y 1 A VAL 279 ? A VAL 279 306 22 Y 1 A GLN 280 ? A GLN 280 307 22 Y 1 A ALA 281 ? A ALA 281 308 22 Y 1 A LEU 282 ? A LEU 282 309 23 Y 1 A MET 1 ? A MET 1 310 23 Y 1 A GLY 2 ? A GLY 2 311 23 Y 1 A ARG 271 ? A ARG 271 312 23 Y 1 A ASP 272 ? A ASP 272 313 23 Y 1 A LEU 273 ? A LEU 273 314 23 Y 1 A PRO 274 ? A PRO 274 315 23 Y 1 A HIS 275 ? A HIS 275 316 23 Y 1 A LEU 276 ? A LEU 276 317 23 Y 1 A PRO 277 ? A PRO 277 318 23 Y 1 A SER 278 ? A SER 278 319 23 Y 1 A VAL 279 ? A VAL 279 320 23 Y 1 A GLN 280 ? A GLN 280 321 23 Y 1 A ALA 281 ? A ALA 281 322 23 Y 1 A LEU 282 ? A LEU 282 323 24 Y 1 A MET 1 ? A MET 1 324 24 Y 1 A GLY 2 ? A GLY 2 325 24 Y 1 A ARG 271 ? A ARG 271 326 24 Y 1 A ASP 272 ? A ASP 272 327 24 Y 1 A LEU 273 ? A LEU 273 328 24 Y 1 A PRO 274 ? A PRO 274 329 24 Y 1 A HIS 275 ? A HIS 275 330 24 Y 1 A LEU 276 ? A LEU 276 331 24 Y 1 A PRO 277 ? A PRO 277 332 24 Y 1 A SER 278 ? A SER 278 333 24 Y 1 A VAL 279 ? A VAL 279 334 24 Y 1 A GLN 280 ? A GLN 280 335 24 Y 1 A ALA 281 ? A ALA 281 336 24 Y 1 A LEU 282 ? A LEU 282 337 25 Y 1 A MET 1 ? A MET 1 338 25 Y 1 A GLY 2 ? A GLY 2 339 25 Y 1 A ARG 271 ? A ARG 271 340 25 Y 1 A ASP 272 ? A ASP 272 341 25 Y 1 A LEU 273 ? A LEU 273 342 25 Y 1 A PRO 274 ? A PRO 274 343 25 Y 1 A HIS 275 ? A HIS 275 344 25 Y 1 A LEU 276 ? A LEU 276 345 25 Y 1 A PRO 277 ? A PRO 277 346 25 Y 1 A SER 278 ? A SER 278 347 25 Y 1 A VAL 279 ? A VAL 279 348 25 Y 1 A GLN 280 ? A GLN 280 349 25 Y 1 A ALA 281 ? A ALA 281 350 25 Y 1 A LEU 282 ? A LEU 282 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '1,5-ANHYDRO-2-C-(CARBOXYMETHYL-N-HYDROXYAMIDE)-2-DEOXY-3-O-MYRISTOYL-D-GLUCITOL' TUX #