data_1XYD # _entry.id 1XYD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1XYD pdb_00001xyd 10.2210/pdb1xyd/pdb RCSB RCSB030905 ? ? WWPDB D_1000030905 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1QLK 'NMR solution structure of rat Ca2+-S100B' unspecified PDB 1B4C 'NMR solution structure of rat apo-S100B using dipolar coupling' unspecified PDB 1DT7 'NMR solution structure of rat Ca2+-S100B with C-terminal negative regulatory domain of p53' unspecified PDB 1MWN 'NMR solution structure of rat Ca2+-S100B with the TRTK-12 peptide' unspecified PDB 3PSR 'Crystal structure of Zn2+-Ca2+-S100A7' unspecified PDB 1ODB 'Crystal structure of Cu2+-Ca2+-S100A12' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XYD _pdbx_database_status.recvd_initial_deposition_date 2004-11-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wilder, P.T.' 1 'Varney, K.M.' 2 'Weber, D.J.' 3 # _citation.id primary _citation.title 'Solution Structure of Zinc- and Calcium-Bound Rat S100B as Determined by Nuclear Magnetic Resonance Spectroscopy' _citation.journal_abbrev Biochemistry _citation.journal_volume 44 _citation.page_first 5690 _citation.page_last 5702 _citation.year 2005 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15823027 _citation.pdbx_database_id_DOI 10.1021/bi0475830 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wilder, P.T.' 1 ? primary 'Varney, K.M.' 2 ? primary 'Weiss, M.B.' 3 ? primary 'Gitti, R.K.' 4 ? primary 'Weber, D.J.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'S-100 protein, beta chain' 10758.048 2 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 4 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name S100B # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM VTTACHEFFEHE ; _entity_poly.pdbx_seq_one_letter_code_can ;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM VTTACHEFFEHE ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 LEU n 1 5 GLU n 1 6 LYS n 1 7 ALA n 1 8 MET n 1 9 VAL n 1 10 ALA n 1 11 LEU n 1 12 ILE n 1 13 ASP n 1 14 VAL n 1 15 PHE n 1 16 HIS n 1 17 GLN n 1 18 TYR n 1 19 SER n 1 20 GLY n 1 21 ARG n 1 22 GLU n 1 23 GLY n 1 24 ASP n 1 25 LYS n 1 26 HIS n 1 27 LYS n 1 28 LEU n 1 29 LYS n 1 30 LYS n 1 31 SER n 1 32 GLU n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 LEU n 1 37 ILE n 1 38 ASN n 1 39 ASN n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 HIS n 1 44 PHE n 1 45 LEU n 1 46 GLU n 1 47 GLU n 1 48 ILE n 1 49 LYS n 1 50 GLU n 1 51 GLN n 1 52 GLU n 1 53 VAL n 1 54 VAL n 1 55 ASP n 1 56 LYS n 1 57 VAL n 1 58 MET n 1 59 GLU n 1 60 THR n 1 61 LEU n 1 62 ASP n 1 63 GLU n 1 64 ASP n 1 65 GLY n 1 66 ASP n 1 67 GLY n 1 68 GLU n 1 69 CYS n 1 70 ASP n 1 71 PHE n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 MET n 1 76 ALA n 1 77 PHE n 1 78 VAL n 1 79 SER n 1 80 MET n 1 81 VAL n 1 82 THR n 1 83 THR n 1 84 ALA n 1 85 CYS n 1 86 HIS n 1 87 GLU n 1 88 PHE n 1 89 PHE n 1 90 GLU n 1 91 HIS n 1 92 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene S100b _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'HMS174(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S100B_RAT _struct_ref.pdbx_db_accession P04631 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM VTTACHEFFEHE ; _struct_ref.pdbx_align_begin 0 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1XYD A 1 ? 92 ? P04631 0 ? 91 ? 0 91 2 1 1XYD B 1 ? 92 ? P04631 0 ? 91 ? 0 91 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 'Fast HSQC' 2 1 1 3D_15N-separated_NOESY 3 1 1 '3D_15N-edited HOHAHA-HSQC' 4 1 1 '3D_15N,15N-edited HMQC-NOESY-HSQC' 5 1 1 HNHA 6 2 1 '3D CBCA(CO)NH' 7 3 1 'Long range HSQC' 8 2 1 '3D HNCA, 3D HNCO, and 3D HNCACB' 9 2 1 4D_13C-separated_NOESY 10 2 1 4D_13C/15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310.15 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '3 mM 15N S100B (monomer concentration), 3 mM Zinc acetate, 10 mM CaCl2, 0.34 mM NaN3, 15 mM NaCl, <0.07 mM DTT, 10 mM TES, 10% D2O' ? 2 ;3 mM 15N,13C S100B (monomer concentration), 3 mM Zinc acetate, 10 mM CaCl2, 0.34 mM NaN3, 15 mM NaCl, <0.07 mM DTT, 10 mM TES, 10% D2O ; ? 3 '1 mM 15N S100B (monomer concentration), 1 mM Zinc acetate, 3.3 mM CaCl2, 0.34 mM NaN3, 15 mM NaCl, <0.07 mM DTT, 10 mM TES, 10% D2O' ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 600 2 ? Bruker AVANCE 800 # _pdbx_nmr_refine.entry_id 1XYD _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1XYD _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe ? processing ? 1 X-PLOR xplor-nih-2.9.2 refinement ? 2 # _exptl.entry_id 1XYD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1XYD _struct.title 'NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XYD _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Metal Binding Protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 2 ? G N N 2 ? H N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 3 ? ARG A 21 ? GLU A 2 ARG A 20 1 ? 19 HELX_P HELX_P2 2 LYS A 30 ? ASN A 39 ? LYS A 29 ASN A 38 1 ? 10 HELX_P HELX_P3 3 GLN A 51 ? ASP A 62 ? GLN A 50 ASP A 61 1 ? 12 HELX_P HELX_P4 4 PHE A 71 ? PHE A 89 ? PHE A 70 PHE A 88 1 ? 19 HELX_P HELX_P5 5 GLU B 3 ? ARG B 21 ? GLU B 2 ARG B 20 1 ? 19 HELX_P HELX_P6 6 LYS B 30 ? ASN B 39 ? LYS B 29 ASN B 38 1 ? 10 HELX_P HELX_P7 7 GLN B 51 ? ASP B 62 ? GLN B 50 ASP B 61 1 ? 12 HELX_P HELX_P8 8 PHE B 71 ? PHE B 89 ? PHE B 70 PHE B 88 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 16 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 15 A ZN 94 1_555 ? ? ? ? ? ? ? 2.025 ? ? metalc2 metalc ? ? A SER 19 O ? ? ? 1_555 C CA . CA ? ? A SER 18 A CA 92 1_555 ? ? ? ? ? ? ? 2.806 ? ? metalc3 metalc ? ? A GLU 22 O ? ? ? 1_555 C CA . CA ? ? A GLU 21 A CA 92 1_555 ? ? ? ? ? ? ? 2.765 ? ? metalc4 metalc ? ? A HIS 26 ND1 ? ? ? 1_555 E ZN . ZN ? ? A HIS 25 A ZN 94 1_555 ? ? ? ? ? ? ? 2.027 ? ? metalc5 metalc ? ? A LYS 27 O ? ? ? 1_555 C CA . CA ? ? A LYS 26 A CA 92 1_555 ? ? ? ? ? ? ? 2.131 ? ? metalc6 metalc ? ? A GLU 32 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 31 A CA 92 1_555 ? ? ? ? ? ? ? 2.756 ? ? metalc7 metalc ? ? A ASP 62 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 61 A CA 93 1_555 ? ? ? ? ? ? ? 2.615 ? ? metalc8 metalc ? ? A ASP 64 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 63 A CA 93 1_555 ? ? ? ? ? ? ? 2.902 ? ? metalc9 metalc ? ? A ASP 64 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 63 A CA 93 1_555 ? ? ? ? ? ? ? 3.376 ? ? metalc10 metalc ? ? A ASP 66 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 65 A CA 93 1_555 ? ? ? ? ? ? ? 2.426 ? ? metalc11 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 65 A CA 93 1_555 ? ? ? ? ? ? ? 2.534 ? ? metalc12 metalc ? ? A GLU 68 O ? ? ? 1_555 D CA . CA ? ? A GLU 67 A CA 93 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc13 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 72 A CA 93 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc14 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 72 A CA 93 1_555 ? ? ? ? ? ? ? 2.191 ? ? metalc15 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 H ZN . ZN ? ? A HIS 85 B ZN 94 1_555 ? ? ? ? ? ? ? 2.014 ? ? metalc16 metalc ? ? A GLU 90 OE1 ? ? ? 1_555 H ZN . ZN ? ? A GLU 89 B ZN 94 1_555 ? ? ? ? ? ? ? 2.100 ? ? metalc17 metalc ? ? E ZN . ZN ? ? ? 1_555 B HIS 86 NE2 ? ? A ZN 94 B HIS 85 1_555 ? ? ? ? ? ? ? 2.018 ? ? metalc18 metalc ? ? E ZN . ZN ? ? ? 1_555 B GLU 90 OE1 ? ? A ZN 94 B GLU 89 1_555 ? ? ? ? ? ? ? 2.106 ? ? metalc19 metalc ? ? B HIS 16 NE2 ? ? ? 1_555 H ZN . ZN ? ? B HIS 15 B ZN 94 1_555 ? ? ? ? ? ? ? 2.025 ? ? metalc20 metalc ? ? B SER 19 O ? ? ? 1_555 F CA . CA ? ? B SER 18 B CA 92 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc21 metalc ? ? B GLU 22 O ? ? ? 1_555 F CA . CA ? ? B GLU 21 B CA 92 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc22 metalc ? ? B HIS 26 ND1 ? ? ? 1_555 H ZN . ZN ? ? B HIS 25 B ZN 94 1_555 ? ? ? ? ? ? ? 2.022 ? ? metalc23 metalc ? ? B LYS 27 O ? ? ? 1_555 F CA . CA ? ? B LYS 26 B CA 92 1_555 ? ? ? ? ? ? ? 2.617 ? ? metalc24 metalc ? ? B GLU 32 OE2 ? ? ? 1_555 F CA . CA ? ? B GLU 31 B CA 92 1_555 ? ? ? ? ? ? ? 2.817 ? ? metalc25 metalc ? ? B ASP 62 OD1 ? ? ? 1_555 G CA . CA ? ? B ASP 61 B CA 93 1_555 ? ? ? ? ? ? ? 2.057 ? ? metalc26 metalc ? ? B ASP 64 OD1 ? ? ? 1_555 G CA . CA ? ? B ASP 63 B CA 93 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc27 metalc ? ? B ASP 66 OD1 ? ? ? 1_555 G CA . CA ? ? B ASP 65 B CA 93 1_555 ? ? ? ? ? ? ? 2.241 ? ? metalc28 metalc ? ? B ASP 66 OD2 ? ? ? 1_555 G CA . CA ? ? B ASP 65 B CA 93 1_555 ? ? ? ? ? ? ? 2.381 ? ? metalc29 metalc ? ? B GLU 68 O ? ? ? 1_555 G CA . CA ? ? B GLU 67 B CA 93 1_555 ? ? ? ? ? ? ? 2.676 ? ? metalc30 metalc ? ? B GLU 73 OE1 ? ? ? 1_555 G CA . CA ? ? B GLU 72 B CA 93 1_555 ? ? ? ? ? ? ? 2.627 ? ? metalc31 metalc ? ? B GLU 73 OE2 ? ? ? 1_555 G CA . CA ? ? B GLU 72 B CA 93 1_555 ? ? ? ? ? ? ? 2.767 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 27 ? LYS A 29 ? LYS A 26 LYS A 28 A 2 GLU A 68 ? ASP A 70 ? GLU A 67 ASP A 69 B 1 LYS B 27 ? LYS B 29 ? LYS B 26 LYS B 28 B 2 GLU B 68 ? ASP B 70 ? GLU B 67 ASP B 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 28 ? N LEU A 27 O CYS A 69 ? O CYS A 68 B 1 2 N LEU B 28 ? N LEU B 27 O CYS B 69 ? O CYS B 68 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 92 ? 6 'BINDING SITE FOR RESIDUE CA A 92' AC2 Software A CA 93 ? 5 'BINDING SITE FOR RESIDUE CA A 93' AC3 Software A ZN 94 ? 5 'BINDING SITE FOR RESIDUE ZN A 94' AC4 Software B CA 92 ? 5 'BINDING SITE FOR RESIDUE CA B 92' AC5 Software B CA 93 ? 5 'BINDING SITE FOR RESIDUE CA B 93' AC6 Software B ZN 94 ? 5 'BINDING SITE FOR RESIDUE ZN B 94' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 TYR A 18 ? TYR A 17 . ? 1_555 ? 2 AC1 6 SER A 19 ? SER A 18 . ? 1_555 ? 3 AC1 6 GLU A 22 ? GLU A 21 . ? 1_555 ? 4 AC1 6 LYS A 27 ? LYS A 26 . ? 1_555 ? 5 AC1 6 LYS A 29 ? LYS A 28 . ? 1_555 ? 6 AC1 6 GLU A 32 ? GLU A 31 . ? 1_555 ? 7 AC2 5 ASP A 62 ? ASP A 61 . ? 1_555 ? 8 AC2 5 ASP A 64 ? ASP A 63 . ? 1_555 ? 9 AC2 5 ASP A 66 ? ASP A 65 . ? 1_555 ? 10 AC2 5 GLU A 68 ? GLU A 67 . ? 1_555 ? 11 AC2 5 GLU A 73 ? GLU A 72 . ? 1_555 ? 12 AC3 5 HIS A 16 ? HIS A 15 . ? 1_555 ? 13 AC3 5 LYS A 25 ? LYS A 24 . ? 1_555 ? 14 AC3 5 HIS A 26 ? HIS A 25 . ? 1_555 ? 15 AC3 5 HIS B 86 ? HIS B 85 . ? 1_555 ? 16 AC3 5 GLU B 90 ? GLU B 89 . ? 1_555 ? 17 AC4 5 TYR B 18 ? TYR B 17 . ? 1_555 ? 18 AC4 5 SER B 19 ? SER B 18 . ? 1_555 ? 19 AC4 5 GLU B 22 ? GLU B 21 . ? 1_555 ? 20 AC4 5 LYS B 27 ? LYS B 26 . ? 1_555 ? 21 AC4 5 GLU B 32 ? GLU B 31 . ? 1_555 ? 22 AC5 5 ASP B 62 ? ASP B 61 . ? 1_555 ? 23 AC5 5 ASP B 64 ? ASP B 63 . ? 1_555 ? 24 AC5 5 ASP B 66 ? ASP B 65 . ? 1_555 ? 25 AC5 5 GLU B 68 ? GLU B 67 . ? 1_555 ? 26 AC5 5 GLU B 73 ? GLU B 72 . ? 1_555 ? 27 AC6 5 HIS A 86 ? HIS A 85 . ? 1_555 ? 28 AC6 5 GLU A 90 ? GLU A 89 . ? 1_555 ? 29 AC6 5 HIS B 16 ? HIS B 15 . ? 1_555 ? 30 AC6 5 LYS B 25 ? LYS B 24 . ? 1_555 ? 31 AC6 5 HIS B 26 ? HIS B 25 . ? 1_555 ? # _database_PDB_matrix.entry_id 1XYD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XYD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 GLU 3 2 2 GLU GLU A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 GLU 5 4 4 GLU GLU A . n A 1 6 LYS 6 5 5 LYS LYS A . n A 1 7 ALA 7 6 6 ALA ALA A . n A 1 8 MET 8 7 7 MET MET A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 ASP 13 12 12 ASP ASP A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 PHE 15 14 14 PHE PHE A . n A 1 16 HIS 16 15 15 HIS HIS A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 TYR 18 17 17 TYR TYR A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 GLY 20 19 19 GLY GLY A . n A 1 21 ARG 21 20 20 ARG ARG A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 ASP 24 23 23 ASP ASP A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 HIS 26 25 25 HIS HIS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 SER 31 30 30 SER SER A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 LYS 34 33 33 LYS LYS A . n A 1 35 GLU 35 34 34 GLU GLU A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 ASN 39 38 38 ASN ASN A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 HIS 43 42 42 HIS HIS A . n A 1 44 PHE 44 43 43 PHE PHE A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 GLU 46 45 45 GLU GLU A . n A 1 47 GLU 47 46 46 GLU GLU A . n A 1 48 ILE 48 47 47 ILE ILE A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 GLN 51 50 50 GLN GLN A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 VAL 54 53 53 VAL VAL A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 VAL 57 56 56 VAL VAL A . n A 1 58 MET 58 57 57 MET MET A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 ASP 64 63 63 ASP ASP A . n A 1 65 GLY 65 64 64 GLY GLY A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 CYS 69 68 68 CYS CYS A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 PHE 71 70 70 PHE PHE A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 GLU 73 72 72 GLU GLU A . n A 1 74 PHE 74 73 73 PHE PHE A . n A 1 75 MET 75 74 74 MET MET A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 PHE 77 76 76 PHE PHE A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 SER 79 78 78 SER SER A . n A 1 80 MET 80 79 79 MET MET A . n A 1 81 VAL 81 80 80 VAL VAL A . n A 1 82 THR 82 81 81 THR THR A . n A 1 83 THR 83 82 82 THR THR A . n A 1 84 ALA 84 83 83 ALA ALA A . n A 1 85 CYS 85 84 84 CYS CYS A . n A 1 86 HIS 86 85 85 HIS HIS A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 PHE 89 88 88 PHE PHE A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 HIS 91 90 90 HIS HIS A . n A 1 92 GLU 92 91 91 GLU GLU A . n B 1 1 MET 1 0 0 MET MET B . n B 1 2 SER 2 1 1 SER SER B . n B 1 3 GLU 3 2 2 GLU GLU B . n B 1 4 LEU 4 3 3 LEU LEU B . n B 1 5 GLU 5 4 4 GLU GLU B . n B 1 6 LYS 6 5 5 LYS LYS B . n B 1 7 ALA 7 6 6 ALA ALA B . n B 1 8 MET 8 7 7 MET MET B . n B 1 9 VAL 9 8 8 VAL VAL B . n B 1 10 ALA 10 9 9 ALA ALA B . n B 1 11 LEU 11 10 10 LEU LEU B . n B 1 12 ILE 12 11 11 ILE ILE B . n B 1 13 ASP 13 12 12 ASP ASP B . n B 1 14 VAL 14 13 13 VAL VAL B . n B 1 15 PHE 15 14 14 PHE PHE B . n B 1 16 HIS 16 15 15 HIS HIS B . n B 1 17 GLN 17 16 16 GLN GLN B . n B 1 18 TYR 18 17 17 TYR TYR B . n B 1 19 SER 19 18 18 SER SER B . n B 1 20 GLY 20 19 19 GLY GLY B . n B 1 21 ARG 21 20 20 ARG ARG B . n B 1 22 GLU 22 21 21 GLU GLU B . n B 1 23 GLY 23 22 22 GLY GLY B . n B 1 24 ASP 24 23 23 ASP ASP B . n B 1 25 LYS 25 24 24 LYS LYS B . n B 1 26 HIS 26 25 25 HIS HIS B . n B 1 27 LYS 27 26 26 LYS LYS B . n B 1 28 LEU 28 27 27 LEU LEU B . n B 1 29 LYS 29 28 28 LYS LYS B . n B 1 30 LYS 30 29 29 LYS LYS B . n B 1 31 SER 31 30 30 SER SER B . n B 1 32 GLU 32 31 31 GLU GLU B . n B 1 33 LEU 33 32 32 LEU LEU B . n B 1 34 LYS 34 33 33 LYS LYS B . n B 1 35 GLU 35 34 34 GLU GLU B . n B 1 36 LEU 36 35 35 LEU LEU B . n B 1 37 ILE 37 36 36 ILE ILE B . n B 1 38 ASN 38 37 37 ASN ASN B . n B 1 39 ASN 39 38 38 ASN ASN B . n B 1 40 GLU 40 39 39 GLU GLU B . n B 1 41 LEU 41 40 40 LEU LEU B . n B 1 42 SER 42 41 41 SER SER B . n B 1 43 HIS 43 42 42 HIS HIS B . n B 1 44 PHE 44 43 43 PHE PHE B . n B 1 45 LEU 45 44 44 LEU LEU B . n B 1 46 GLU 46 45 45 GLU GLU B . n B 1 47 GLU 47 46 46 GLU GLU B . n B 1 48 ILE 48 47 47 ILE ILE B . n B 1 49 LYS 49 48 48 LYS LYS B . n B 1 50 GLU 50 49 49 GLU GLU B . n B 1 51 GLN 51 50 50 GLN GLN B . n B 1 52 GLU 52 51 51 GLU GLU B . n B 1 53 VAL 53 52 52 VAL VAL B . n B 1 54 VAL 54 53 53 VAL VAL B . n B 1 55 ASP 55 54 54 ASP ASP B . n B 1 56 LYS 56 55 55 LYS LYS B . n B 1 57 VAL 57 56 56 VAL VAL B . n B 1 58 MET 58 57 57 MET MET B . n B 1 59 GLU 59 58 58 GLU GLU B . n B 1 60 THR 60 59 59 THR THR B . n B 1 61 LEU 61 60 60 LEU LEU B . n B 1 62 ASP 62 61 61 ASP ASP B . n B 1 63 GLU 63 62 62 GLU GLU B . n B 1 64 ASP 64 63 63 ASP ASP B . n B 1 65 GLY 65 64 64 GLY GLY B . n B 1 66 ASP 66 65 65 ASP ASP B . n B 1 67 GLY 67 66 66 GLY GLY B . n B 1 68 GLU 68 67 67 GLU GLU B . n B 1 69 CYS 69 68 68 CYS CYS B . n B 1 70 ASP 70 69 69 ASP ASP B . n B 1 71 PHE 71 70 70 PHE PHE B . n B 1 72 GLN 72 71 71 GLN GLN B . n B 1 73 GLU 73 72 72 GLU GLU B . n B 1 74 PHE 74 73 73 PHE PHE B . n B 1 75 MET 75 74 74 MET MET B . n B 1 76 ALA 76 75 75 ALA ALA B . n B 1 77 PHE 77 76 76 PHE PHE B . n B 1 78 VAL 78 77 77 VAL VAL B . n B 1 79 SER 79 78 78 SER SER B . n B 1 80 MET 80 79 79 MET MET B . n B 1 81 VAL 81 80 80 VAL VAL B . n B 1 82 THR 82 81 81 THR THR B . n B 1 83 THR 83 82 82 THR THR B . n B 1 84 ALA 84 83 83 ALA ALA B . n B 1 85 CYS 85 84 84 CYS CYS B . n B 1 86 HIS 86 85 85 HIS HIS B . n B 1 87 GLU 87 86 86 GLU GLU B . n B 1 88 PHE 88 87 87 PHE PHE B . n B 1 89 PHE 89 88 88 PHE PHE B . n B 1 90 GLU 90 89 89 GLU GLU B . n B 1 91 HIS 91 90 90 HIS HIS B . n B 1 92 GLU 92 91 91 GLU GLU B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 CA 1 92 92 CA CA A . D 2 CA 1 93 93 CA CA A . E 3 ZN 1 94 94 ZN ZN A . F 2 CA 1 92 92 CA CA B . G 2 CA 1 93 93 CA CA B . H 3 ZN 1 94 94 ZN ZN B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 16 ? A HIS 15 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 ND1 ? A HIS 26 ? A HIS 25 ? 1_555 107.9 ? 2 NE2 ? A HIS 16 ? A HIS 15 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 NE2 ? B HIS 86 ? B HIS 85 ? 1_555 124.7 ? 3 ND1 ? A HIS 26 ? A HIS 25 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 NE2 ? B HIS 86 ? B HIS 85 ? 1_555 115.3 ? 4 NE2 ? A HIS 16 ? A HIS 15 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 OE1 ? B GLU 90 ? B GLU 89 ? 1_555 114.6 ? 5 ND1 ? A HIS 26 ? A HIS 25 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 OE1 ? B GLU 90 ? B GLU 89 ? 1_555 118.2 ? 6 NE2 ? B HIS 86 ? B HIS 85 ? 1_555 ZN ? E ZN . ? A ZN 94 ? 1_555 OE1 ? B GLU 90 ? B GLU 89 ? 1_555 72.9 ? 7 O ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O ? A GLU 22 ? A GLU 21 ? 1_555 69.8 ? 8 O ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 70.2 ? 9 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O ? A LYS 27 ? A LYS 26 ? 1_555 110.0 ? 10 O ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 129.5 ? 11 O ? A GLU 22 ? A GLU 21 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 111.1 ? 12 O ? A LYS 27 ? A LYS 26 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31 ? 1_555 138.6 ? 13 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 50.7 ? 14 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 88.3 ? 15 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 39.2 ? 16 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD2 ? A ASP 66 ? A ASP 65 ? 1_555 99.2 ? 17 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD2 ? A ASP 66 ? A ASP 65 ? 1_555 66.3 ? 18 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD2 ? A ASP 66 ? A ASP 65 ? 1_555 61.9 ? 19 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 58.4 ? 20 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 64.6 ? 21 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 92.4 ? 22 OD2 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 51.4 ? 23 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 94.8 ? 24 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 122.4 ? 25 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 140.9 ? 26 OD2 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 79.2 ? 27 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O ? A GLU 68 ? A GLU 67 ? 1_555 57.7 ? 28 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 93.0 ? 29 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 106.7 ? 30 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 96.9 ? 31 OD2 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 154.8 ? 32 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 149.7 ? 33 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 121.7 ? 34 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 148.7 ? 35 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 128.2 ? 36 OD2 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 90.8 ? 37 OD2 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 107.9 ? 38 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 152.8 ? 39 O ? A GLU 68 ? A GLU 67 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 105.2 ? 40 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 56.0 ? 41 NE2 ? A HIS 86 ? A HIS 85 ? 1_555 ZN ? H ZN . ? B ZN 94 ? 1_555 OE1 ? A GLU 90 ? A GLU 89 ? 1_555 73.1 ? 42 NE2 ? A HIS 86 ? A HIS 85 ? 1_555 ZN ? H ZN . ? B ZN 94 ? 1_555 NE2 ? B HIS 16 ? B HIS 15 ? 1_555 124.0 ? 43 OE1 ? A GLU 90 ? A GLU 89 ? 1_555 ZN ? H ZN . ? B ZN 94 ? 1_555 NE2 ? B HIS 16 ? B HIS 15 ? 1_555 113.9 ? 44 NE2 ? A HIS 86 ? A HIS 85 ? 1_555 ZN ? H ZN . ? B ZN 94 ? 1_555 ND1 ? B HIS 26 ? B HIS 25 ? 1_555 115.8 ? 45 OE1 ? A GLU 90 ? A GLU 89 ? 1_555 ZN ? H ZN . ? B ZN 94 ? 1_555 ND1 ? B HIS 26 ? B HIS 25 ? 1_555 118.8 ? 46 NE2 ? B HIS 16 ? B HIS 15 ? 1_555 ZN ? H ZN . ? B ZN 94 ? 1_555 ND1 ? B HIS 26 ? B HIS 25 ? 1_555 108.1 ? 47 O ? B SER 19 ? B SER 18 ? 1_555 CA ? F CA . ? B CA 92 ? 1_555 O ? B GLU 22 ? B GLU 21 ? 1_555 83.0 ? 48 O ? B SER 19 ? B SER 18 ? 1_555 CA ? F CA . ? B CA 92 ? 1_555 O ? B LYS 27 ? B LYS 26 ? 1_555 69.9 ? 49 O ? B GLU 22 ? B GLU 21 ? 1_555 CA ? F CA . ? B CA 92 ? 1_555 O ? B LYS 27 ? B LYS 26 ? 1_555 107.3 ? 50 O ? B SER 19 ? B SER 18 ? 1_555 CA ? F CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31 ? 1_555 147.6 ? 51 O ? B GLU 22 ? B GLU 21 ? 1_555 CA ? F CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31 ? 1_555 122.2 ? 52 O ? B LYS 27 ? B LYS 26 ? 1_555 CA ? F CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31 ? 1_555 114.7 ? 53 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 66.0 ? 54 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 71.6 ? 55 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 80.4 ? 56 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OD2 ? B ASP 66 ? B ASP 65 ? 1_555 119.8 ? 57 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OD2 ? B ASP 66 ? B ASP 65 ? 1_555 78.1 ? 58 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OD2 ? B ASP 66 ? B ASP 65 ? 1_555 55.5 ? 59 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 O ? B GLU 68 ? B GLU 67 ? 1_555 100.9 ? 60 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 O ? B GLU 68 ? B GLU 67 ? 1_555 137.0 ? 61 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 O ? B GLU 68 ? B GLU 67 ? 1_555 56.8 ? 62 OD2 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 O ? B GLU 68 ? B GLU 67 ? 1_555 74.1 ? 63 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 100.9 ? 64 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 119.7 ? 65 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 154.4 ? 66 OD2 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 139.2 ? 67 O ? B GLU 68 ? B GLU 67 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 102.7 ? 68 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 147.1 ? 69 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 130.4 ? 70 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 133.0 ? 71 OD2 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 92.8 ? 72 O ? B GLU 68 ? B GLU 67 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 83.5 ? 73 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 CA ? G CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 47.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-06-07 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.value' 24 4 'Structure model' '_struct_conn.pdbx_dist_value' 25 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 26 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 33 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 34 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 36 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 37 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 38 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 39 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 40 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 41 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 10 ? ? H A PHE 14 ? ? 1.40 2 1 O B LEU 10 ? ? H B PHE 14 ? ? 1.40 3 1 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.40 4 1 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.40 5 1 O B VAL 77 ? ? HG1 B THR 81 ? ? 1.42 6 1 O A VAL 52 ? ? H A VAL 56 ? ? 1.50 7 1 O B VAL 52 ? ? H B VAL 56 ? ? 1.50 8 1 O A GLU 31 ? ? H A LEU 35 ? ? 1.52 9 1 O B GLU 31 ? ? H B LEU 35 ? ? 1.52 10 1 O A SER 1 ? ? H A GLU 4 ? ? 1.55 11 1 O B VAL 77 ? ? H B THR 81 ? ? 1.55 12 1 O B SER 1 ? ? H B GLU 4 ? ? 1.55 13 1 O A VAL 77 ? ? H A THR 81 ? ? 1.55 14 2 HG A SER 78 ? ? O B PHE 70 ? ? 1.45 15 2 O B LEU 10 ? ? H B PHE 14 ? ? 1.48 16 2 O A LEU 10 ? ? H A PHE 14 ? ? 1.48 17 2 O B GLU 31 ? ? H B LEU 35 ? ? 1.51 18 2 O A GLU 31 ? ? H A LEU 35 ? ? 1.51 19 2 O B VAL 52 ? ? H B VAL 56 ? ? 1.52 20 2 O A VAL 52 ? ? H A VAL 56 ? ? 1.52 21 2 O A THR 82 ? ? H A GLU 86 ? ? 1.55 22 2 O B THR 82 ? ? H B GLU 86 ? ? 1.56 23 2 OD1 A ASP 61 ? ? H A ASP 65 ? ? 1.57 24 2 OD1 B ASP 61 ? ? H B ASP 65 ? ? 1.57 25 2 O B LYS 28 ? ? H B GLU 31 ? ? 1.58 26 2 O A LYS 28 ? ? H A GLU 31 ? ? 1.58 27 2 O A SER 78 ? ? HG1 A THR 82 ? ? 1.59 28 3 O A VAL 77 ? ? HG1 A THR 81 ? ? 1.41 29 3 O A LEU 10 ? ? H A PHE 14 ? ? 1.43 30 3 O B LEU 10 ? ? H B PHE 14 ? ? 1.43 31 3 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.45 32 3 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.46 33 3 O A MET 57 ? ? H A ASP 61 ? ? 1.54 34 3 O B MET 57 ? ? H B ASP 61 ? ? 1.55 35 3 O B VAL 77 ? ? H B THR 81 ? ? 1.57 36 3 O A VAL 77 ? ? H A THR 81 ? ? 1.57 37 4 O B LEU 10 ? ? H B PHE 14 ? ? 1.42 38 4 O A LEU 10 ? ? H A PHE 14 ? ? 1.42 39 4 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.47 40 4 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.47 41 4 O B LYS 28 ? ? H B GLU 31 ? ? 1.52 42 4 O A LYS 28 ? ? H A GLU 31 ? ? 1.52 43 4 O A GLU 31 ? ? H A LEU 35 ? ? 1.53 44 4 O B GLU 31 ? ? H B LEU 35 ? ? 1.54 45 4 O B MET 57 ? ? H B ASP 61 ? ? 1.54 46 4 O A MET 57 ? ? H A ASP 61 ? ? 1.54 47 4 H1 B MET 0 ? ? OE1 B GLU 4 ? ? 1.58 48 5 O B LEU 10 ? ? H B PHE 14 ? ? 1.43 49 5 O A LEU 10 ? ? H A PHE 14 ? ? 1.43 50 5 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.45 51 5 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.45 52 5 O B VAL 77 ? ? HG1 B THR 81 ? ? 1.50 53 5 O A LYS 28 ? ? H A GLU 31 ? ? 1.53 54 5 O B LYS 28 ? ? H B GLU 31 ? ? 1.53 55 5 O B MET 57 ? ? H B ASP 61 ? ? 1.56 56 5 O A MET 57 ? ? H A ASP 61 ? ? 1.56 57 5 O A VAL 77 ? ? H A THR 81 ? ? 1.59 58 5 O B VAL 77 ? ? H B THR 81 ? ? 1.59 59 6 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.46 60 6 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.46 61 6 O B LEU 10 ? ? H B PHE 14 ? ? 1.47 62 6 O A LEU 10 ? ? H A PHE 14 ? ? 1.47 63 6 O A MET 57 ? ? H A ASP 61 ? ? 1.51 64 6 O B MET 57 ? ? H B ASP 61 ? ? 1.51 65 6 O A LYS 28 ? ? H A GLU 31 ? ? 1.52 66 6 O B LYS 28 ? ? H B GLU 31 ? ? 1.52 67 6 O A VAL 77 ? ? H A THR 81 ? ? 1.55 68 6 O B VAL 77 ? ? H B THR 81 ? ? 1.56 69 6 HE1 B HIS 25 ? ? ZN B ZN 94 ? ? 1.57 70 6 O A SER 78 ? ? H A THR 82 ? ? 1.58 71 6 O B SER 78 ? ? H B THR 82 ? ? 1.58 72 7 O B LEU 10 ? ? H B PHE 14 ? ? 1.44 73 7 O A LEU 10 ? ? H A PHE 14 ? ? 1.44 74 7 O B GLU 31 ? ? H B LEU 35 ? ? 1.52 75 7 O A GLU 31 ? ? H A LEU 35 ? ? 1.52 76 7 O A VAL 77 ? ? H A THR 81 ? ? 1.53 77 7 O B VAL 77 ? ? H B THR 81 ? ? 1.53 78 7 O B VAL 52 ? ? H B VAL 56 ? ? 1.54 79 7 O A VAL 52 ? ? H A VAL 56 ? ? 1.54 80 7 O A THR 82 ? ? H A GLU 86 ? ? 1.55 81 7 O B THR 82 ? ? H B GLU 86 ? ? 1.55 82 7 O A MET 57 ? ? H A ASP 61 ? ? 1.60 83 7 O B MET 57 ? ? H B ASP 61 ? ? 1.60 84 8 O B LEU 10 ? ? H B PHE 14 ? ? 1.43 85 8 O A LEU 10 ? ? H A PHE 14 ? ? 1.43 86 8 OD1 B ASP 69 ? ? H B PHE 70 ? ? 1.53 87 8 OD1 A ASP 69 ? ? H A PHE 70 ? ? 1.53 88 8 HG A SER 78 ? ? O B PHE 70 ? ? 1.53 89 8 O A MET 57 ? ? H A ASP 61 ? ? 1.54 90 8 O B MET 57 ? ? H B ASP 61 ? ? 1.55 91 8 O B THR 82 ? ? H B HIS 85 ? ? 1.56 92 8 O A THR 82 ? ? H A HIS 85 ? ? 1.56 93 8 O A LYS 28 ? ? H A GLU 31 ? ? 1.57 94 8 O B LYS 28 ? ? H B GLU 31 ? ? 1.57 95 8 O A VAL 77 ? ? HG1 A THR 81 ? ? 1.57 96 8 O A VAL 77 ? ? H A THR 81 ? ? 1.58 97 8 O B VAL 77 ? ? H B THR 81 ? ? 1.59 98 8 O A TYR 17 ? ? H A ARG 20 ? ? 1.60 99 8 O B TYR 17 ? ? H B ARG 20 ? ? 1.60 100 9 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.40 101 9 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.40 102 9 O A LEU 10 ? ? H A PHE 14 ? ? 1.43 103 9 O B LEU 10 ? ? H B PHE 14 ? ? 1.43 104 9 O A VAL 77 ? ? HG1 A THR 81 ? ? 1.50 105 9 O B VAL 77 ? ? HG1 B THR 81 ? ? 1.51 106 9 O B GLU 31 ? ? H B LEU 35 ? ? 1.55 107 9 O A GLU 31 ? ? H A LEU 35 ? ? 1.55 108 9 O A LYS 28 ? ? H A GLU 31 ? ? 1.57 109 9 O B LYS 28 ? ? H B GLU 31 ? ? 1.57 110 9 O A VAL 52 ? ? H A VAL 56 ? ? 1.59 111 9 O B VAL 52 ? ? H B VAL 56 ? ? 1.59 112 10 O A LEU 10 ? ? H A PHE 14 ? ? 1.43 113 10 O B LEU 10 ? ? H B PHE 14 ? ? 1.44 114 10 O A MET 57 ? ? H A ASP 61 ? ? 1.51 115 10 O B MET 57 ? ? H B ASP 61 ? ? 1.51 116 10 O A LYS 28 ? ? H A GLU 31 ? ? 1.53 117 10 O A PHE 14 ? ? HG A SER 18 ? ? 1.53 118 10 O A GLU 31 ? ? H A LEU 35 ? ? 1.53 119 10 O B GLU 31 ? ? H B LEU 35 ? ? 1.53 120 10 O B LYS 28 ? ? H B GLU 31 ? ? 1.53 121 10 O A VAL 77 ? ? H A THR 81 ? ? 1.60 122 11 HE2 A HIS 42 ? ? HG B SER 1 ? ? 1.30 123 11 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.40 124 11 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.40 125 11 O B LEU 10 ? ? H B PHE 14 ? ? 1.44 126 11 O A LEU 10 ? ? H A PHE 14 ? ? 1.44 127 11 O B THR 82 ? ? H B GLU 86 ? ? 1.49 128 11 O A THR 82 ? ? H A GLU 86 ? ? 1.49 129 11 O B GLU 31 ? ? H B LEU 35 ? ? 1.52 130 11 O A GLU 31 ? ? H A LEU 35 ? ? 1.52 131 11 O A MET 57 ? ? H A ASP 61 ? ? 1.54 132 11 O B MET 57 ? ? H B ASP 61 ? ? 1.54 133 11 O B LYS 28 ? ? H B GLU 31 ? ? 1.55 134 11 O A LYS 28 ? ? H A GLU 31 ? ? 1.56 135 11 O A VAL 77 ? ? H A THR 81 ? ? 1.57 136 11 O B VAL 77 ? ? H B THR 81 ? ? 1.57 137 12 HG A SER 1 ? ? H A GLU 4 ? ? 1.31 138 12 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.38 139 12 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.38 140 12 O A LEU 10 ? ? H A PHE 14 ? ? 1.44 141 12 O B LEU 10 ? ? H B PHE 14 ? ? 1.44 142 12 O A LYS 5 ? ? H A ALA 9 ? ? 1.53 143 12 O B LYS 5 ? ? H B ALA 9 ? ? 1.53 144 12 O A VAL 77 ? ? H A THR 81 ? ? 1.54 145 12 O B VAL 77 ? ? H B THR 81 ? ? 1.54 146 12 O B LYS 28 ? ? H B GLU 31 ? ? 1.54 147 12 O A LYS 28 ? ? H A GLU 31 ? ? 1.55 148 12 O B GLU 31 ? ? H B LEU 35 ? ? 1.56 149 12 O A GLU 31 ? ? H A LEU 35 ? ? 1.57 150 12 O A VAL 52 ? ? H A VAL 56 ? ? 1.58 151 12 O B VAL 52 ? ? H B VAL 56 ? ? 1.59 152 12 OH A TYR 17 ? ? HD21 A ASN 38 ? ? 1.59 153 12 OH B TYR 17 ? ? HD21 B ASN 38 ? ? 1.60 154 12 NE2 B HIS 25 ? ? ZN B ZN 94 ? ? 1.67 155 12 NE2 A HIS 25 ? ? ZN A ZN 94 ? ? 1.67 156 13 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.40 157 13 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.40 158 13 O B LEU 10 ? ? H B PHE 14 ? ? 1.45 159 13 O A LEU 10 ? ? H A PHE 14 ? ? 1.45 160 13 O A VAL 77 ? ? HG1 A THR 81 ? ? 1.56 161 13 O A GLU 31 ? ? H A LEU 35 ? ? 1.57 162 13 O B GLU 31 ? ? H B LEU 35 ? ? 1.57 163 14 O A VAL 77 ? ? HG1 A THR 81 ? ? 1.42 164 14 O A LEU 10 ? ? H A PHE 14 ? ? 1.44 165 14 O B LEU 10 ? ? H B PHE 14 ? ? 1.44 166 14 O B LYS 28 ? ? H B GLU 31 ? ? 1.50 167 14 O A MET 57 ? ? H A ASP 61 ? ? 1.51 168 14 O B MET 57 ? ? H B ASP 61 ? ? 1.51 169 14 O A LYS 28 ? ? H A GLU 31 ? ? 1.51 170 14 O A GLU 21 ? ? HZ1 A LYS 28 ? ? 1.52 171 14 O B GLU 21 ? ? HZ2 B LYS 28 ? ? 1.53 172 14 O A THR 82 ? ? H A GLU 86 ? ? 1.57 173 14 O B THR 82 ? ? H B GLU 86 ? ? 1.57 174 14 O A GLU 31 ? ? H A LEU 35 ? ? 1.58 175 14 O B GLU 31 ? ? H B LEU 35 ? ? 1.59 176 15 O A LEU 10 ? ? H A PHE 14 ? ? 1.45 177 15 O B LEU 10 ? ? H B PHE 14 ? ? 1.45 178 15 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.52 179 15 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.53 180 15 O A MET 57 ? ? H A ASP 61 ? ? 1.56 181 15 O B MET 57 ? ? H B ASP 61 ? ? 1.57 182 15 O A TYR 17 ? ? H A ARG 20 ? ? 1.57 183 15 O B TYR 17 ? ? H B ARG 20 ? ? 1.57 184 15 O B VAL 52 ? ? H B VAL 56 ? ? 1.58 185 15 O A VAL 52 ? ? H A VAL 56 ? ? 1.58 186 15 HE1 A HIS 25 ? ? ZN A ZN 94 ? ? 1.59 187 15 HE1 B HIS 25 ? ? ZN B ZN 94 ? ? 1.59 188 15 O A SER 78 ? ? H A THR 82 ? ? 1.60 189 16 O A LEU 10 ? ? H A PHE 14 ? ? 1.44 190 16 O B LEU 10 ? ? H B PHE 14 ? ? 1.44 191 16 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.45 192 16 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.45 193 16 O B LYS 28 ? ? H B GLU 31 ? ? 1.51 194 16 O A LYS 28 ? ? H A GLU 31 ? ? 1.52 195 16 O A VAL 52 ? ? H A VAL 56 ? ? 1.53 196 16 O B VAL 52 ? ? H B VAL 56 ? ? 1.53 197 16 O B MET 57 ? ? H B ASP 61 ? ? 1.54 198 16 O A MET 57 ? ? H A ASP 61 ? ? 1.54 199 16 O B GLU 31 ? ? H B LEU 35 ? ? 1.54 200 16 O A GLU 31 ? ? H A LEU 35 ? ? 1.54 201 16 O B VAL 77 ? ? HG1 B THR 81 ? ? 1.60 202 16 O A SER 1 ? ? H A GLU 4 ? ? 1.60 203 16 O B SER 1 ? ? H B GLU 4 ? ? 1.60 204 17 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.41 205 17 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.41 206 17 O B LEU 10 ? ? H B PHE 14 ? ? 1.47 207 17 O A LEU 10 ? ? H A PHE 14 ? ? 1.47 208 17 O B THR 82 ? ? H B GLU 86 ? ? 1.48 209 17 O A THR 82 ? ? H A GLU 86 ? ? 1.48 210 17 O B PHE 14 ? ? HG B SER 18 ? ? 1.50 211 17 O A LYS 28 ? ? H A GLU 31 ? ? 1.53 212 17 HG A SER 78 ? ? O B PHE 70 ? ? 1.53 213 17 O B LYS 28 ? ? H B GLU 31 ? ? 1.53 214 17 HD2 A HIS 15 ? ? ZN A ZN 94 ? ? 1.56 215 17 HD2 B HIS 15 ? ? ZN B ZN 94 ? ? 1.57 216 18 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.42 217 18 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.42 218 18 O B LEU 10 ? ? H B PHE 14 ? ? 1.45 219 18 O A LEU 10 ? ? H A PHE 14 ? ? 1.45 220 18 O B GLU 31 ? ? H B LEU 35 ? ? 1.58 221 18 O A GLU 31 ? ? H A LEU 35 ? ? 1.58 222 19 O B LEU 10 ? ? H B PHE 14 ? ? 1.44 223 19 O A LEU 10 ? ? H A PHE 14 ? ? 1.44 224 19 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.45 225 19 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.46 226 19 OD1 B ASP 69 ? ? H B PHE 70 ? ? 1.54 227 19 O B LYS 28 ? ? H B GLU 31 ? ? 1.55 228 19 OD1 A ASP 69 ? ? H A PHE 70 ? ? 1.55 229 19 O B THR 82 ? ? H B GLU 86 ? ? 1.55 230 19 O A THR 82 ? ? H A GLU 86 ? ? 1.56 231 19 O A LYS 28 ? ? H A GLU 31 ? ? 1.56 232 19 O B SER 1 ? ? H B GLU 4 ? ? 1.59 233 19 O A SER 1 ? ? H A GLU 4 ? ? 1.59 234 19 O B VAL 52 ? ? H B VAL 56 ? ? 1.60 235 20 O A LEU 10 ? ? H A PHE 14 ? ? 1.46 236 20 O B LEU 10 ? ? H B PHE 14 ? ? 1.46 237 20 OD2 B ASP 61 ? ? H B GLY 66 ? ? 1.46 238 20 OD2 A ASP 61 ? ? H A GLY 66 ? ? 1.46 239 20 O B VAL 52 ? ? H B VAL 56 ? ? 1.49 240 20 O A VAL 52 ? ? H A VAL 56 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 24 ? ? -179.59 -7.58 2 1 HIS A 25 ? ? -153.93 47.79 3 1 SER A 30 ? ? -49.01 -10.79 4 1 GLU A 39 ? ? -100.16 -69.95 5 1 LEU A 40 ? ? -76.19 37.81 6 1 ASP A 69 ? ? -53.00 -169.91 7 1 LYS B 24 ? ? -179.63 -7.55 8 1 HIS B 25 ? ? -153.90 47.73 9 1 SER B 30 ? ? -48.92 -10.80 10 1 GLU B 39 ? ? -100.16 -69.98 11 1 LEU B 40 ? ? -76.19 37.88 12 1 ASP B 69 ? ? -53.07 -170.04 13 2 LYS A 24 ? ? -179.66 -42.80 14 2 SER A 30 ? ? -48.85 -11.60 15 2 GLU A 39 ? ? -102.39 -61.10 16 2 LEU A 40 ? ? -78.11 34.96 17 2 ASP A 61 ? ? -55.04 108.86 18 2 ASP A 69 ? ? -51.76 -176.36 19 2 HIS A 90 ? ? -57.70 102.26 20 2 LYS B 24 ? ? -179.74 -42.85 21 2 SER B 30 ? ? -49.07 -11.29 22 2 GLU B 39 ? ? -102.30 -60.88 23 2 LEU B 40 ? ? -78.25 34.97 24 2 ASP B 61 ? ? -54.98 108.74 25 2 ASP B 69 ? ? -52.01 -176.22 26 2 HIS B 90 ? ? -57.63 102.09 27 3 LYS A 24 ? ? 169.13 144.31 28 3 LEU A 40 ? ? -75.11 31.60 29 3 ASP A 61 ? ? -55.41 98.87 30 3 ASP A 69 ? ? -53.05 -175.13 31 3 GLU A 89 ? ? -82.74 47.22 32 3 LYS B 24 ? ? 168.65 144.22 33 3 LEU B 40 ? ? -74.60 31.00 34 3 ASP B 61 ? ? -55.60 99.13 35 3 ASP B 69 ? ? -53.00 -175.25 36 3 GLU B 89 ? ? -82.67 47.14 37 4 ASP A 23 ? ? -49.52 -93.81 38 4 LYS A 24 ? ? -171.95 -8.95 39 4 HIS A 25 ? ? -142.92 35.02 40 4 SER A 30 ? ? -49.80 -15.76 41 4 GLU A 39 ? ? -99.35 -69.53 42 4 LEU A 40 ? ? -73.91 38.92 43 4 GLU A 46 ? ? -55.51 84.83 44 4 ASP A 61 ? ? -55.97 96.08 45 4 ASP A 69 ? ? -52.49 -173.56 46 4 GLU A 89 ? ? -71.96 20.75 47 4 ASP B 23 ? ? -49.75 -93.97 48 4 LYS B 24 ? ? -171.77 -8.93 49 4 HIS B 25 ? ? -142.76 34.97 50 4 SER B 30 ? ? -49.60 -15.78 51 4 GLU B 39 ? ? -99.20 -69.46 52 4 LEU B 40 ? ? -73.97 38.79 53 4 GLU B 46 ? ? -55.37 84.77 54 4 ASP B 61 ? ? -56.07 96.03 55 4 ASP B 69 ? ? -52.36 -173.63 56 4 GLU B 89 ? ? -72.08 20.75 57 5 ASP A 23 ? ? -46.20 165.90 58 5 SER A 30 ? ? -48.75 -13.63 59 5 LEU A 40 ? ? -79.78 27.90 60 5 GLU A 46 ? ? -59.76 89.63 61 5 ASP A 61 ? ? -55.78 106.69 62 5 ASP A 69 ? ? -50.47 -175.18 63 5 GLU A 89 ? ? -68.78 -99.84 64 5 ASP B 23 ? ? -46.39 166.01 65 5 SER B 30 ? ? -48.85 -13.46 66 5 LEU B 40 ? ? -79.67 27.89 67 5 GLU B 46 ? ? -59.85 89.77 68 5 ASP B 61 ? ? -55.62 106.54 69 5 ASP B 69 ? ? -50.49 -175.14 70 5 GLU B 89 ? ? -68.52 -99.80 71 6 ASP A 23 ? ? -40.30 157.63 72 6 SER A 30 ? ? -49.28 -16.08 73 6 GLU A 39 ? ? -104.66 -61.18 74 6 LEU A 40 ? ? -74.77 35.76 75 6 ASP A 61 ? ? -56.06 100.93 76 6 ASP A 69 ? ? -52.77 -174.32 77 6 HIS A 90 ? ? -53.65 100.16 78 6 ASP B 23 ? ? -40.33 158.11 79 6 SER B 30 ? ? -48.75 -16.61 80 6 GLU B 39 ? ? -105.44 -60.64 81 6 LEU B 40 ? ? -74.83 35.44 82 6 ASP B 61 ? ? -55.98 100.44 83 6 ASP B 69 ? ? -52.73 -174.91 84 6 HIS B 90 ? ? -52.60 100.11 85 7 ASP A 23 ? ? -46.86 -81.06 86 7 LYS A 24 ? ? -172.97 -8.11 87 7 HIS A 25 ? ? -155.52 46.94 88 7 SER A 30 ? ? -46.46 -12.46 89 7 GLU A 39 ? ? -103.52 -63.98 90 7 LEU A 40 ? ? -76.80 37.04 91 7 ASP A 69 ? ? -53.91 -166.48 92 7 ASP B 23 ? ? -46.82 -81.08 93 7 LYS B 24 ? ? -172.91 -8.08 94 7 HIS B 25 ? ? -155.59 46.93 95 7 SER B 30 ? ? -46.36 -12.56 96 7 GLU B 39 ? ? -103.52 -63.92 97 7 LEU B 40 ? ? -76.88 37.16 98 7 ASP B 69 ? ? -53.80 -166.48 99 8 LYS A 24 ? ? -171.92 -8.31 100 8 HIS A 25 ? ? -163.45 68.16 101 8 GLU A 39 ? ? -130.57 -50.32 102 8 GLU A 46 ? ? -46.81 90.39 103 8 ASP A 69 ? ? -55.84 -169.33 104 8 LYS B 24 ? ? -171.93 -8.30 105 8 HIS B 25 ? ? -163.45 68.14 106 8 GLU B 39 ? ? -130.49 -50.31 107 8 GLU B 46 ? ? -46.92 90.52 108 8 ASP B 69 ? ? -55.85 -169.42 109 9 ASP A 23 ? ? -49.76 -82.75 110 9 LYS A 24 ? ? -171.31 -9.38 111 9 HIS A 25 ? ? -160.24 53.23 112 9 SER A 30 ? ? -49.33 -14.03 113 9 GLU A 39 ? ? -100.19 -70.19 114 9 LEU A 40 ? ? -72.37 39.33 115 9 ASP A 61 ? ? -54.92 109.38 116 9 ASP A 69 ? ? -54.38 -170.75 117 9 HIS A 90 ? ? -68.24 99.96 118 9 ASP B 23 ? ? -49.44 -82.80 119 9 LYS B 24 ? ? -171.33 -9.34 120 9 HIS B 25 ? ? -160.18 53.33 121 9 SER B 30 ? ? -49.35 -13.95 122 9 GLU B 39 ? ? -100.09 -70.33 123 9 LEU B 40 ? ? -72.39 39.33 124 9 ASP B 61 ? ? -54.91 109.57 125 9 ASP B 69 ? ? -54.38 -170.82 126 9 HIS B 90 ? ? -68.31 99.70 127 10 SER A 1 ? ? 88.69 12.91 128 10 ASP A 23 ? ? -47.14 -80.48 129 10 LYS A 24 ? ? -179.06 -7.40 130 10 HIS A 25 ? ? -152.99 46.84 131 10 SER A 30 ? ? -48.45 -12.09 132 10 GLU A 39 ? ? -120.53 -51.12 133 10 LEU A 40 ? ? -79.00 21.22 134 10 GLU A 46 ? ? -67.66 99.32 135 10 ASP A 61 ? ? -56.03 108.46 136 10 ASP A 69 ? ? -52.33 -170.33 137 10 SER B 1 ? ? 88.74 13.33 138 10 ASP B 23 ? ? -46.98 -80.45 139 10 LYS B 24 ? ? -179.12 -7.25 140 10 HIS B 25 ? ? -153.20 46.88 141 10 SER B 30 ? ? -48.49 -12.06 142 10 GLU B 39 ? ? -120.49 -50.98 143 10 LEU B 40 ? ? -79.01 21.13 144 10 GLU B 46 ? ? -67.25 99.20 145 10 ASP B 61 ? ? -56.02 108.35 146 10 ASP B 69 ? ? -52.28 -170.28 147 11 ASP A 23 ? ? -54.88 -113.33 148 11 LYS A 24 ? ? -171.99 -17.83 149 11 GLU A 39 ? ? -98.99 -66.84 150 11 LEU A 40 ? ? -76.55 39.30 151 11 PHE A 43 ? ? -98.76 -62.35 152 11 GLU A 46 ? ? -59.70 103.18 153 11 ASP A 61 ? ? -58.32 101.22 154 11 ASP A 69 ? ? -55.29 -163.28 155 11 ASP B 23 ? ? -54.79 -113.08 156 11 LYS B 24 ? ? -172.09 -17.92 157 11 GLU B 39 ? ? -99.19 -66.88 158 11 LEU B 40 ? ? -76.27 39.31 159 11 PHE B 43 ? ? -98.46 -62.40 160 11 GLU B 46 ? ? -59.71 103.12 161 11 ASP B 61 ? ? -57.97 101.29 162 11 ASP B 69 ? ? -55.17 -163.09 163 12 LYS A 24 ? ? -176.37 -41.05 164 12 SER A 30 ? ? -48.62 -15.14 165 12 GLU A 39 ? ? -105.92 -67.63 166 12 LEU A 40 ? ? -74.00 35.50 167 12 ASP A 61 ? ? -55.93 104.20 168 12 ASP A 69 ? ? -52.31 -175.56 169 12 GLU A 89 ? ? -67.45 -102.26 170 12 LYS B 24 ? ? -176.18 -40.97 171 12 SER B 30 ? ? -48.46 -15.16 172 12 GLU B 39 ? ? -105.89 -67.81 173 12 LEU B 40 ? ? -73.63 35.44 174 12 ASP B 61 ? ? -55.90 104.14 175 12 ASP B 69 ? ? -52.44 -175.58 176 12 GLU B 89 ? ? -67.30 -102.16 177 13 SER A 1 ? ? 83.12 2.28 178 13 LYS A 24 ? ? -178.19 -4.58 179 13 HIS A 25 ? ? -153.51 50.30 180 13 LEU A 40 ? ? -81.09 34.93 181 13 ASP A 61 ? ? -55.75 108.92 182 13 ASP A 69 ? ? -53.82 -172.72 183 13 GLU A 89 ? ? -97.83 35.18 184 13 SER B 1 ? ? 83.26 2.15 185 13 LYS B 24 ? ? -178.23 -4.80 186 13 HIS B 25 ? ? -153.43 50.46 187 13 LEU B 40 ? ? -80.53 34.74 188 13 ASP B 61 ? ? -55.66 108.98 189 13 ASP B 69 ? ? -53.67 -172.75 190 13 GLU B 89 ? ? -97.74 34.94 191 14 SER A 1 ? ? 74.37 -151.92 192 14 ASP A 23 ? ? -47.17 171.87 193 14 HIS A 25 ? ? -170.47 67.92 194 14 GLU A 39 ? ? -107.76 -65.57 195 14 LEU A 40 ? ? -72.57 28.61 196 14 ASP A 61 ? ? -55.47 108.77 197 14 ASP A 69 ? ? -53.40 -169.24 198 14 GLU A 89 ? ? -75.86 22.90 199 14 SER B 1 ? ? 74.17 -151.86 200 14 ASP B 23 ? ? -47.04 171.84 201 14 HIS B 25 ? ? -170.54 67.89 202 14 GLU B 39 ? ? -107.52 -65.61 203 14 LEU B 40 ? ? -72.47 28.40 204 14 ASP B 61 ? ? -55.47 108.86 205 14 ASP B 69 ? ? -53.33 -169.31 206 14 GLU B 89 ? ? -75.94 22.84 207 15 ASP A 23 ? ? -74.94 34.45 208 15 LYS A 24 ? ? 45.59 171.69 209 15 LEU A 40 ? ? -76.18 32.75 210 15 GLU A 46 ? ? -58.54 100.98 211 15 ASP A 61 ? ? -57.26 88.63 212 15 ASP A 69 ? ? -50.35 -173.24 213 15 GLU A 89 ? ? -89.86 33.46 214 15 ASP B 23 ? ? -74.86 34.33 215 15 LYS B 24 ? ? 45.65 171.74 216 15 LEU B 40 ? ? -76.21 32.74 217 15 GLU B 46 ? ? -58.44 100.91 218 15 ASP B 61 ? ? -57.28 88.60 219 15 ASP B 69 ? ? -50.28 -173.31 220 15 GLU B 89 ? ? -89.73 33.43 221 16 SER A 1 ? ? -107.30 75.38 222 16 HIS A 25 ? ? 82.90 -7.02 223 16 GLU A 39 ? ? -105.53 -63.98 224 16 LEU A 40 ? ? -73.95 33.79 225 16 GLU A 46 ? ? -56.00 82.11 226 16 ASP A 61 ? ? -55.87 104.93 227 16 ASP A 69 ? ? -54.11 -167.30 228 16 SER B 1 ? ? -107.47 75.38 229 16 HIS B 25 ? ? 82.87 -6.87 230 16 GLU B 39 ? ? -105.66 -63.86 231 16 LEU B 40 ? ? -74.22 34.06 232 16 GLU B 46 ? ? -56.02 82.02 233 16 ASP B 61 ? ? -55.94 104.99 234 16 ASP B 69 ? ? -54.13 -167.28 235 17 LYS A 24 ? ? -169.47 -9.49 236 17 HIS A 25 ? ? -168.05 61.69 237 17 LEU A 40 ? ? -71.74 28.78 238 17 GLU A 46 ? ? -54.63 82.63 239 17 ASP A 61 ? ? -56.34 105.68 240 17 ASP A 69 ? ? -52.15 -176.76 241 17 LYS B 24 ? ? -169.76 -9.24 242 17 HIS B 25 ? ? -168.28 61.84 243 17 LEU B 40 ? ? -71.59 28.83 244 17 GLU B 46 ? ? -54.64 82.72 245 17 ASP B 61 ? ? -56.06 105.77 246 17 ASP B 69 ? ? -52.16 -176.76 247 18 HIS A 25 ? ? -165.80 66.51 248 18 GLU A 39 ? ? -129.99 -53.26 249 18 LEU A 40 ? ? -85.89 31.44 250 18 ASP A 61 ? ? -56.13 98.97 251 18 ASP A 69 ? ? -50.73 -171.63 252 18 HIS B 25 ? ? -165.64 66.57 253 18 GLU B 39 ? ? -129.96 -53.26 254 18 LEU B 40 ? ? -85.89 31.56 255 18 ASP B 61 ? ? -56.26 98.94 256 18 ASP B 69 ? ? -50.65 -171.69 257 19 ASP A 23 ? ? -78.43 29.98 258 19 LYS A 24 ? ? 66.24 -12.44 259 19 HIS A 25 ? ? -152.14 47.98 260 19 LEU A 40 ? ? -87.42 32.22 261 19 GLU A 46 ? ? -57.95 84.55 262 19 ASP A 61 ? ? -56.02 104.12 263 19 ASP A 69 ? ? -49.76 178.46 264 19 GLU A 89 ? ? -84.80 -114.44 265 19 ASP B 23 ? ? -78.58 29.05 266 19 LYS B 24 ? ? 67.14 -12.07 267 19 HIS B 25 ? ? -152.26 47.93 268 19 LEU B 40 ? ? -87.17 31.58 269 19 GLU B 46 ? ? -58.37 84.96 270 19 ASP B 61 ? ? -55.77 104.20 271 19 ASP B 69 ? ? -49.99 179.16 272 19 GLU B 89 ? ? -84.57 -114.63 273 20 ASP A 23 ? ? -44.41 105.10 274 20 GLU A 39 ? ? -108.47 -63.48 275 20 LEU A 40 ? ? -72.09 30.09 276 20 GLU A 46 ? ? -56.32 95.76 277 20 ASP A 61 ? ? -55.88 102.41 278 20 ASP A 69 ? ? -54.05 -174.56 279 20 ASP B 23 ? ? -44.34 105.03 280 20 GLU B 39 ? ? -108.56 -63.51 281 20 LEU B 40 ? ? -72.12 30.11 282 20 GLU B 46 ? ? -56.21 95.76 283 20 ASP B 61 ? ? -56.03 102.43 284 20 ASP B 69 ? ? -53.86 -174.56 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'ZINC ION' ZN #