data_1XYH # _entry.id 1XYH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1XYH RCSB RCSB030908 WWPDB D_1000030908 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XYH _pdbx_database_status.recvd_initial_deposition_date 2004-11-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huang, L.-L.' 1 'Zhao, X.-M.' 2 'Huang, C.-Q.' 3 'Yu, L.' 4 'Xia, Z.-X.' 5 # _citation.id primary _citation.title 'Structure of recombinant human cyclophilin J, a novel member of the cyclophilin family.' _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 61 _citation.page_first 316 _citation.page_last 321 _citation.year 2005 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15735342 _citation.pdbx_database_id_DOI 10.1107/S0907444904033189 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Huang, L.L.' 1 primary 'Zhao, X.M.' 2 primary 'Huang, C.Q.' 3 primary 'Yu, L.' 4 primary 'Xia, Z.X.' 5 # _cell.entry_id 1XYH _cell.length_a 41.309 _cell.length_b 41.309 _cell.length_c 172.116 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XYH _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'cyclophilin-like protein PPIL3b' 18177.547 1 5.2.1.8 ? ? ? 2 water nat water 18.015 26 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cyclophilin J' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA Q ; _entity_poly.pdbx_seq_one_letter_code_can ;MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA Q ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 VAL n 1 4 THR n 1 5 LEU n 1 6 HIS n 1 7 THR n 1 8 ASP n 1 9 VAL n 1 10 GLY n 1 11 ASP n 1 12 ILE n 1 13 LYS n 1 14 ILE n 1 15 GLU n 1 16 VAL n 1 17 PHE n 1 18 CYS n 1 19 GLU n 1 20 ARG n 1 21 THR n 1 22 PRO n 1 23 LYS n 1 24 THR n 1 25 CYS n 1 26 GLU n 1 27 ASN n 1 28 PHE n 1 29 LEU n 1 30 ALA n 1 31 LEU n 1 32 CYS n 1 33 ALA n 1 34 SER n 1 35 ASN n 1 36 TYR n 1 37 TYR n 1 38 ASN n 1 39 GLY n 1 40 CYS n 1 41 ILE n 1 42 PHE n 1 43 HIS n 1 44 ARG n 1 45 ASN n 1 46 ILE n 1 47 LYS n 1 48 GLY n 1 49 PHE n 1 50 MET n 1 51 VAL n 1 52 GLN n 1 53 THR n 1 54 GLY n 1 55 ASP n 1 56 PRO n 1 57 THR n 1 58 GLY n 1 59 THR n 1 60 GLY n 1 61 ARG n 1 62 GLY n 1 63 GLY n 1 64 ASN n 1 65 SER n 1 66 ILE n 1 67 TRP n 1 68 GLY n 1 69 LYS n 1 70 LYS n 1 71 PHE n 1 72 GLU n 1 73 ASP n 1 74 GLU n 1 75 TYR n 1 76 SER n 1 77 GLU n 1 78 TYR n 1 79 LEU n 1 80 LYS n 1 81 HIS n 1 82 ASN n 1 83 VAL n 1 84 ARG n 1 85 GLY n 1 86 VAL n 1 87 VAL n 1 88 SER n 1 89 MET n 1 90 ALA n 1 91 ASN n 1 92 ASN n 1 93 GLY n 1 94 PRO n 1 95 ASN n 1 96 THR n 1 97 ASN n 1 98 GLY n 1 99 SER n 1 100 GLN n 1 101 PHE n 1 102 PHE n 1 103 ILE n 1 104 THR n 1 105 TYR n 1 106 GLY n 1 107 LYS n 1 108 GLN n 1 109 PRO n 1 110 HIS n 1 111 LEU n 1 112 ASP n 1 113 MET n 1 114 LYS n 1 115 TYR n 1 116 THR n 1 117 VAL n 1 118 PHE n 1 119 GLY n 1 120 LYS n 1 121 VAL n 1 122 ILE n 1 123 ASP n 1 124 GLY n 1 125 LEU n 1 126 GLU n 1 127 THR n 1 128 LEU n 1 129 ASP n 1 130 GLU n 1 131 LEU n 1 132 GLU n 1 133 LYS n 1 134 LEU n 1 135 PRO n 1 136 VAL n 1 137 ASN n 1 138 GLU n 1 139 LYS n 1 140 THR n 1 141 TYR n 1 142 ARG n 1 143 PRO n 1 144 LEU n 1 145 ASN n 1 146 ASP n 1 147 VAL n 1 148 HIS n 1 149 ILE n 1 150 LYS n 1 151 ASP n 1 152 ILE n 1 153 THR n 1 154 ILE n 1 155 HIS n 1 156 ALA n 1 157 ASN n 1 158 PRO n 1 159 PHE n 1 160 ALA n 1 161 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene PPIL3b _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ 'fetal brain' _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTXB1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9H2H8_HUMAN _struct_ref.pdbx_db_accession Q9H2H8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLK HNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA Q ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XYH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 161 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H2H8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1XYH _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.35 _exptl_crystal.density_percent_sol 47.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.6 _exptl_crystal_grow.pdbx_details 'Tris-HCl, PEG8000, DMSO, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 293.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type BRUKER _diffrn_detector.pdbx_collection_date 2004-06-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator graphite _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'SEALED TUBE' _diffrn_source.type OTHER _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 1XYH _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 27.51 _reflns.d_resolution_high 2.6 _reflns.number_obs 5560 _reflns.number_all 5798 _reflns.percent_possible_obs 95.9 _reflns.pdbx_Rmerge_I_obs 0.084 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 30.8 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 92.4 _reflns_shell.Rmerge_I_obs 0.372 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 499 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1XYH _refine.ls_number_reflns_obs 5333 _refine.ls_number_reflns_all 5333 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 227854.65 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.51 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 93.0 _refine.ls_R_factor_obs 0.175 _refine.ls_R_factor_all 0.181 _refine.ls_R_factor_R_work 0.175 _refine.ls_R_factor_R_free 0.236 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.6 _refine.ls_number_reflns_R_free 567 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 28.4 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 5.07 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.301138 _refine.solvent_model_param_bsol 26.4574 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 2CPL' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'maximum likelyhood target using amplitude' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1XYH _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs 0.29 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.35 _refine_analyze.Luzzati_sigma_a_free 0.42 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1267 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 1293 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 27.51 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.9 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.67 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.41 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.38 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.23 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.48 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.69 _refine_ls_shell.number_reflns_R_work 391 _refine_ls_shell.R_factor_R_work 0.248 _refine_ls_shell.percent_reflns_obs 83.2 _refine_ls_shell.R_factor_R_free 0.363 _refine_ls_shell.R_factor_R_free_error 0.051 _refine_ls_shell.percent_reflns_R_free 11.5 _refine_ls_shell.number_reflns_R_free 51 _refine_ls_shell.number_reflns_obs 499 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1XYH _struct.title 'Crystal Structure of Recombinant Human Cyclophilin J' _struct.pdbx_descriptor 'cyclophilin-like protein PPIL3b (E.C.5.2.1.8)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XYH _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'cyclophilin J, beta-barrel, helix, disulfide bridge, ISOMERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 17 ? THR A 21 ? PHE A 17 THR A 21 1 ? 5 HELX_P HELX_P2 2 PRO A 22 ? SER A 34 ? PRO A 22 SER A 34 1 ? 13 HELX_P HELX_P3 3 GLN A 108 ? ASP A 112 ? GLN A 108 ASP A 112 5 ? 5 HELX_P HELX_P4 4 GLY A 124 ? LEU A 134 ? GLY A 124 LEU A 134 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 18 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 25 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 18 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 25 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.020 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 39 ? ILE A 46 ? GLY A 39 ILE A 46 A 2 PHE A 49 ? THR A 53 ? PHE A 49 THR A 53 A 3 GLN A 100 ? TYR A 105 ? GLN A 100 TYR A 105 A 4 GLY A 85 ? ALA A 90 ? GLY A 85 ALA A 90 A 5 THR A 116 ? ASP A 123 ? THR A 116 ASP A 123 A 6 ASP A 11 ? VAL A 16 ? ASP A 11 VAL A 16 A 7 MET A 1 ? HIS A 6 ? MET A 1 HIS A 6 A 8 VAL A 147 ? HIS A 155 ? VAL A 147 HIS A 155 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 44 ? O ARG A 44 N GLN A 52 ? N GLN A 52 A 2 3 N VAL A 51 ? N VAL A 51 O ILE A 103 ? O ILE A 103 A 3 4 N THR A 104 ? N THR A 104 O VAL A 86 ? O VAL A 86 A 4 5 N VAL A 87 ? N VAL A 87 O GLY A 119 ? O GLY A 119 A 5 6 O LYS A 120 ? O LYS A 120 N GLU A 15 ? N GLU A 15 A 6 7 O ILE A 14 ? O ILE A 14 N VAL A 3 ? N VAL A 3 A 7 8 N HIS A 6 ? N HIS A 6 O ASP A 151 ? O ASP A 151 # _database_PDB_matrix.entry_id 1XYH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XYH _atom_sites.fract_transf_matrix[1][1] 0.024208 _atom_sites.fract_transf_matrix[1][2] 0.013976 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.027953 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005810 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLN 161 161 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 201 HOH HOH A . B 2 HOH 2 202 202 HOH HOH A . B 2 HOH 3 203 203 HOH HOH A . B 2 HOH 4 204 204 HOH HOH A . B 2 HOH 5 205 205 HOH HOH A . B 2 HOH 6 206 206 HOH HOH A . B 2 HOH 7 207 207 HOH HOH A . B 2 HOH 8 208 208 HOH HOH A . B 2 HOH 9 209 209 HOH HOH A . B 2 HOH 10 210 210 HOH HOH A . B 2 HOH 11 211 211 HOH HOH A . B 2 HOH 12 212 212 HOH HOH A . B 2 HOH 13 213 213 HOH HOH A . B 2 HOH 14 214 214 HOH HOH A . B 2 HOH 15 215 215 HOH HOH A . B 2 HOH 16 216 216 HOH HOH A . B 2 HOH 17 217 217 HOH HOH A . B 2 HOH 18 218 218 HOH HOH A . B 2 HOH 19 219 219 HOH HOH A . B 2 HOH 20 220 220 HOH HOH A . B 2 HOH 21 221 221 HOH HOH A . B 2 HOH 22 222 222 HOH HOH A . B 2 HOH 23 223 223 HOH HOH A . B 2 HOH 24 224 224 HOH HOH A . B 2 HOH 25 225 225 HOH HOH A . B 2 HOH 26 226 226 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-15 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data reduction' . ? 2 HKL-2000 'data scaling' . ? 3 AMoRE phasing . ? 4 # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 17 ? ? -103.96 74.15 2 1 PHE A 49 ? ? -118.07 -72.73 3 1 ASN A 92 ? ? -116.86 56.87 4 1 GLN A 108 ? ? -143.18 53.03 5 1 PRO A 158 ? ? -23.27 104.50 6 1 PHE A 159 ? ? -170.33 -77.59 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLN _pdbx_unobs_or_zero_occ_residues.auth_seq_id 161 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLN _pdbx_unobs_or_zero_occ_residues.label_seq_id 161 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #