data_1Y0N # _entry.id 1Y0N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Y0N pdb_00001y0n 10.2210/pdb1y0n/pdb RCSB RCSB030966 ? ? WWPDB D_1000030966 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-12-21 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-03-06 5 'Structure model' 1 4 2024-12-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 5 'Structure model' Advisory 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_related 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_validate_close_contact 10 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_related.db_name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Y0N _pdbx_database_status.recvd_initial_deposition_date 2004-11-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id apc5056 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Binkowski, T.A.' 1 'Edwards, A.' 2 'Savchenko, A.' 3 'Skarina, T.' 4 'Gorodichtchenskaia, E.' 5 'Joachimiak, A.' 6 'Midwest Center for Structural Genomics (MCSG)' 7 # _citation.id primary _citation.title 'Hypothetical protein PA3463 from Pseudomonas aeruginosa strain PAO1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Binkowski, T.A.' 1 ? primary 'Edwards, A.' 2 ? primary 'Savchenko, A.' 3 ? primary 'Skarina, T.' 4 ? primary 'Gorodichtchenskaia, E.' 5 ? primary 'Joachimiak, A.' 6 ? primary 'Midwest Center for Structural Genomics (MCSG)' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical UPF0270 protein PA3463' 8902.952 1 ? ? ? ? 2 non-polymer syn GLYCEROL 92.094 4 ? ? ? ? 3 water nat water 18.015 28 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GHMLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD _entity_poly.pdbx_seq_one_letter_code_can GHMLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC5056 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 LEU n 1 5 ILE n 1 6 PRO n 1 7 HIS n 1 8 ASP n 1 9 LEU n 1 10 LEU n 1 11 GLU n 1 12 ALA n 1 13 ASP n 1 14 THR n 1 15 LEU n 1 16 ASN n 1 17 ASN n 1 18 LEU n 1 19 LEU n 1 20 GLU n 1 21 ASP n 1 22 PHE n 1 23 VAL n 1 24 THR n 1 25 ARG n 1 26 GLU n 1 27 GLY n 1 28 THR n 1 29 ASP n 1 30 ASN n 1 31 GLY n 1 32 ASP n 1 33 GLU n 1 34 THR n 1 35 PRO n 1 36 LEU n 1 37 ASP n 1 38 VAL n 1 39 ARG n 1 40 VAL n 1 41 GLU n 1 42 ARG n 1 43 ALA n 1 44 ARG n 1 45 HIS n 1 46 ALA n 1 47 LEU n 1 48 ARG n 1 49 ARG n 1 50 GLY n 1 51 GLU n 1 52 ALA n 1 53 VAL n 1 54 ILE n 1 55 LEU n 1 56 PHE n 1 57 ASP n 1 58 PRO n 1 59 GLU n 1 60 SER n 1 61 GLN n 1 62 GLN n 1 63 CYS n 1 64 GLN n 1 65 LEU n 1 66 MET n 1 67 LEU n 1 68 ARG n 1 69 SER n 1 70 GLU n 1 71 VAL n 1 72 PRO n 1 73 ALA n 1 74 GLU n 1 75 LEU n 1 76 LEU n 1 77 ARG n 1 78 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene PA3463 _entity_src_gen.gene_src_species 'Pseudomonas aeruginosa' _entity_src_gen.gene_src_strain PAO1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 HIS 2 0 0 HIS HIS A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 LEU 4 2 2 LEU LEU A . n A 1 5 ILE 5 3 3 ILE ILE A . n A 1 6 PRO 6 4 4 PRO PRO A . n A 1 7 HIS 7 5 5 HIS HIS A . n A 1 8 ASP 8 6 6 ASP ASP A . n A 1 9 LEU 9 7 7 LEU LEU A . n A 1 10 LEU 10 8 8 LEU LEU A . n A 1 11 GLU 11 9 9 GLU GLU A . n A 1 12 ALA 12 10 10 ALA ALA A . n A 1 13 ASP 13 11 11 ASP ASP A . n A 1 14 THR 14 12 12 THR THR A . n A 1 15 LEU 15 13 13 LEU LEU A . n A 1 16 ASN 16 14 14 ASN ASN A . n A 1 17 ASN 17 15 15 ASN ASN A . n A 1 18 LEU 18 16 16 LEU LEU A . n A 1 19 LEU 19 17 17 LEU LEU A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 ASP 21 19 19 ASP ASP A . n A 1 22 PHE 22 20 20 PHE PHE A . n A 1 23 VAL 23 21 21 VAL VAL A . n A 1 24 THR 24 22 22 THR THR A . n A 1 25 ARG 25 23 23 ARG ARG A . n A 1 26 GLU 26 24 ? ? ? A . n A 1 27 GLY 27 25 ? ? ? A . n A 1 28 THR 28 26 ? ? ? A . n A 1 29 ASP 29 27 ? ? ? A . n A 1 30 ASN 30 28 ? ? ? A . n A 1 31 GLY 31 29 ? ? ? A . n A 1 32 ASP 32 30 ? ? ? A . n A 1 33 GLU 33 31 31 GLU GLU A . n A 1 34 THR 34 32 32 THR THR A . n A 1 35 PRO 35 33 33 PRO PRO A . n A 1 36 LEU 36 34 34 LEU LEU A . n A 1 37 ASP 37 35 35 ASP ASP A . n A 1 38 VAL 38 36 36 VAL VAL A . n A 1 39 ARG 39 37 37 ARG ARG A . n A 1 40 VAL 40 38 38 VAL VAL A . n A 1 41 GLU 41 39 39 GLU GLU A . n A 1 42 ARG 42 40 40 ARG ARG A . n A 1 43 ALA 43 41 41 ALA ALA A . n A 1 44 ARG 44 42 42 ARG ARG A . n A 1 45 HIS 45 43 43 HIS HIS A . n A 1 46 ALA 46 44 44 ALA ALA A . n A 1 47 LEU 47 45 45 LEU LEU A . n A 1 48 ARG 48 46 46 ARG ARG A . n A 1 49 ARG 49 47 47 ARG ARG A . n A 1 50 GLY 50 48 48 GLY GLY A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 ALA 52 50 50 ALA ALA A . n A 1 53 VAL 53 51 51 VAL VAL A . n A 1 54 ILE 54 52 52 ILE ILE A . n A 1 55 LEU 55 53 53 LEU LEU A . n A 1 56 PHE 56 54 54 PHE PHE A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 PRO 58 56 56 PRO PRO A . n A 1 59 GLU 59 57 57 GLU GLU A . n A 1 60 SER 60 58 58 SER SER A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 GLN 62 60 60 GLN GLN A . n A 1 63 CYS 63 61 61 CYS CYS A . n A 1 64 GLN 64 62 62 GLN GLN A . n A 1 65 LEU 65 63 63 LEU LEU A . n A 1 66 MET 66 64 64 MET MET A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 ARG 68 66 66 ARG ARG A . n A 1 69 SER 69 67 67 SER SER A . n A 1 70 GLU 70 68 68 GLU GLU A . n A 1 71 VAL 71 69 69 VAL VAL A . n A 1 72 PRO 72 70 70 PRO PRO A . n A 1 73 ALA 73 71 71 ALA ALA A . n A 1 74 GLU 74 72 72 GLU GLU A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 LEU 76 74 74 LEU LEU A . n A 1 77 ARG 77 75 75 ARG ARG A . n A 1 78 ASP 78 76 76 ASP ASP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 101 1 GOL GOL A . C 2 GOL 1 104 4 GOL GOL A . D 2 GOL 1 102 2 GOL GOL A . E 2 GOL 1 103 3 GOL GOL A . F 3 HOH 1 105 1 HOH HOH A . F 3 HOH 2 106 2 HOH HOH A . F 3 HOH 3 107 3 HOH HOH A . F 3 HOH 4 108 4 HOH HOH A . F 3 HOH 5 109 5 HOH HOH A . F 3 HOH 6 110 11 HOH HOH A . F 3 HOH 7 111 12 HOH HOH A . F 3 HOH 8 112 14 HOH HOH A . F 3 HOH 9 113 17 HOH HOH A . F 3 HOH 10 114 19 HOH HOH A . F 3 HOH 11 115 20 HOH HOH A . F 3 HOH 12 116 21 HOH HOH A . F 3 HOH 13 117 25 HOH HOH A . F 3 HOH 14 118 28 HOH HOH A . F 3 HOH 15 119 30 HOH HOH A . F 3 HOH 16 120 31 HOH HOH A . F 3 HOH 17 121 32 HOH HOH A . F 3 HOH 18 122 33 HOH HOH A . F 3 HOH 19 123 37 HOH HOH A . F 3 HOH 20 124 39 HOH HOH A . F 3 HOH 21 125 40 HOH HOH A . F 3 HOH 22 126 42 HOH HOH A . F 3 HOH 23 127 43 HOH HOH A . F 3 HOH 24 128 47 HOH HOH A . F 3 HOH 25 129 49 HOH HOH A . F 3 HOH 26 130 57 HOH HOH A . F 3 HOH 27 131 65 HOH HOH A . F 3 HOH 28 132 68 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 HKL-2000 'data reduction' . ? 2 HKL-2000 'data scaling' . ? 3 SHARP phasing . ? 4 # _cell.entry_id 1Y0N _cell.length_a 78.311 _cell.length_b 78.311 _cell.length_c 52.510 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1Y0N _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1Y0N _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.81 _exptl_crystal.density_percent_sol 56.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details 'Na Citrate 1.4M, 0.1M Hepes Na, pH 7.5, VAPOR DIFFUSION, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 150 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC-2 _diffrn_detector.pdbx_collection_date 2004-07-21 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength .97945 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list .97945 # _reflns.entry_id 1Y0N _reflns.number_all ? _reflns.number_obs 6791 _reflns.percent_possible_obs ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 28.51 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.002 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1Y0N _refine.ls_number_reflns_obs 6366 _refine.ls_number_reflns_all 6688 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 28.51 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 98.57 _refine.ls_R_factor_obs 0.24761 _refine.ls_R_factor_all 0.24761 _refine.ls_R_factor_R_work 0.24565 _refine.ls_R_factor_R_free 0.28893 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 322 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.936 _refine.correlation_coeff_Fo_to_Fc_free 0.919 _refine.B_iso_mean 42.996 _refine.aniso_B[1][1] -0.12 _refine.aniso_B[2][2] -0.12 _refine.aniso_B[3][3] 0.18 _refine.aniso_B[1][2] -0.06 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.202 _refine.pdbx_overall_ESU_R_Free 0.185 _refine.overall_SU_ML 0.128 _refine.overall_SU_B 8.785 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 574 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 626 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 28.51 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.022 0.021 ? 601 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.075 2.019 ? 805 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.919 5.000 ? 69 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.133 23.438 ? 32 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.117 15.000 ? 106 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 20.833 15.000 ? 8 'X-RAY DIFFRACTION' ? r_chiral_restr 0.140 0.200 ? 92 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 440 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.269 0.200 ? 247 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.300 0.200 ? 389 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.323 0.200 ? 33 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.689 0.200 ? 65 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.509 0.200 ? 9 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.594 1.500 ? 370 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.622 2.000 ? 573 'X-RAY DIFFRACTION' ? r_scbond_it 3.922 3.000 ? 248 'X-RAY DIFFRACTION' ? r_scangle_it 5.607 4.500 ? 232 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.002 _refine_ls_shell.d_res_low 2.053 _refine_ls_shell.number_reflns_R_work 404 _refine_ls_shell.R_factor_R_work 0.399 _refine_ls_shell.percent_reflns_obs 88.91 _refine_ls_shell.R_factor_R_free 0.501 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 1Y0N _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1Y0N _struct.title 'Structure of Protein of Unknown Function PA3463 from Pseudomonas aeruginosa PAO1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Y0N _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;MCSG, Midwest Center for Structural Genomics, Protein Structure Initiative, PSI, structural genomics, Pseudomonsa aeruginosa, hypothetical protein, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y3463_PSEAE _struct_ref.pdbx_db_accession Q9HYE3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Y0N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HYE3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1Y0N GLY A 1 ? UNP Q9HYE3 ? ? 'cloning artifact' -1 1 1 1Y0N HIS A 2 ? UNP Q9HYE3 ? ? 'cloning artifact' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 6 ? LEU A 10 ? PRO A 4 LEU A 8 5 ? 5 HELX_P HELX_P2 2 GLU A 11 ? ARG A 25 ? GLU A 9 ARG A 23 1 ? 15 HELX_P HELX_P3 3 PRO A 35 ? ARG A 49 ? PRO A 33 ARG A 47 1 ? 15 HELX_P HELX_P4 4 SER A 69 ? VAL A 71 ? SER A 67 VAL A 69 5 ? 3 HELX_P HELX_P5 5 PRO A 72 ? LEU A 76 ? PRO A 70 LEU A 74 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id D _struct_conn.ptnr1_label_comp_id GOL _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id O3 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id C _struct_conn.ptnr2_label_comp_id GOL _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id O1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GOL _struct_conn.ptnr1_auth_seq_id 102 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GOL _struct_conn.ptnr2_auth_seq_id 104 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.968 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 1 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id -1 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 2 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 0 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -13.04 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 3 ? LEU A 4 ? MET A 1 LEU A 2 A 2 ALA A 52 ? PHE A 56 ? ALA A 50 PHE A 54 A 3 CYS A 63 ? LEU A 67 ? CYS A 61 LEU A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 3 ? N MET A 1 O PHE A 56 ? O PHE A 54 A 2 3 N VAL A 53 ? N VAL A 51 O MET A 66 ? O MET A 64 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 101 ? 6 'BINDING SITE FOR RESIDUE GOL A 101' AC2 Software A GOL 104 ? 6 'BINDING SITE FOR RESIDUE GOL A 104' AC3 Software A GOL 102 ? 8 'BINDING SITE FOR RESIDUE GOL A 102' AC4 Software A GOL 103 ? 7 'BINDING SITE FOR RESIDUE GOL A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ILE A 5 ? ILE A 3 . ? 1_555 ? 2 AC1 6 PRO A 6 ? PRO A 4 . ? 1_555 ? 3 AC1 6 HIS A 7 ? HIS A 5 . ? 1_555 ? 4 AC1 6 VAL A 53 ? VAL A 51 . ? 1_555 ? 5 AC1 6 ILE A 54 ? ILE A 52 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 109 . ? 1_555 ? 7 AC2 6 GLU A 51 ? GLU A 49 . ? 1_555 ? 8 AC2 6 SER A 69 ? SER A 67 . ? 7_555 ? 9 AC2 6 GOL D . ? GOL A 102 . ? 1_555 ? 10 AC2 6 GOL D . ? GOL A 102 . ? 7_555 ? 11 AC2 6 HOH F . ? HOH A 116 . ? 7_555 ? 12 AC2 6 HOH F . ? HOH A 118 . ? 1_555 ? 13 AC3 8 GLU A 51 ? GLU A 49 . ? 7_555 ? 14 AC3 8 ARG A 68 ? ARG A 66 . ? 1_555 ? 15 AC3 8 ARG A 68 ? ARG A 66 . ? 7_555 ? 16 AC3 8 SER A 69 ? SER A 67 . ? 1_555 ? 17 AC3 8 SER A 69 ? SER A 67 . ? 7_555 ? 18 AC3 8 GOL C . ? GOL A 104 . ? 1_555 ? 19 AC3 8 GOL C . ? GOL A 104 . ? 7_555 ? 20 AC3 8 HOH F . ? HOH A 106 . ? 7_555 ? 21 AC4 7 HIS A 45 ? HIS A 43 . ? 11_555 ? 22 AC4 7 HIS A 45 ? HIS A 43 . ? 1_555 ? 23 AC4 7 ARG A 49 ? ARG A 47 . ? 11_555 ? 24 AC4 7 PRO A 72 ? PRO A 70 . ? 6_555 ? 25 AC4 7 ALA A 73 ? ALA A 71 . ? 6_555 ? 26 AC4 7 HOH F . ? HOH A 131 . ? 1_555 ? 27 AC4 7 HOH F . ? HOH A 132 . ? 1_555 ? # _pdbx_entry_details.entry_id 1Y0N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 3 ? ? O2 A GOL 101 ? ? 1.76 2 1 O2 A GOL 103 ? ? O A HOH 132 ? ? 1.96 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 SD A MET 1 ? ? 1_555 CE A MET 1 ? ? 10_444 0.56 2 1 O1 A GOL 102 ? ? 1_555 C3 A GOL 102 ? ? 7_555 1.35 3 1 C1 A GOL 102 ? ? 1_555 C2 A GOL 102 ? ? 7_555 1.49 4 1 C1 A GOL 102 ? ? 1_555 C3 A GOL 102 ? ? 7_555 1.58 5 1 SD A MET 1 ? ? 1_555 SD A MET 1 ? ? 10_444 1.65 6 1 C2 A GOL 102 ? ? 1_555 C3 A GOL 102 ? ? 7_555 1.70 7 1 CE A MET 1 ? ? 1_555 CE A MET 1 ? ? 10_444 1.76 8 1 N A GLY -1 ? ? 1_555 OD1 A ASP 35 ? ? 5_554 1.83 9 1 C1 A GOL 102 ? ? 1_555 O3 A GOL 102 ? ? 7_555 1.89 10 1 O1 A GOL 102 ? ? 1_555 O3 A GOL 102 ? ? 7_555 1.92 11 1 O A HOH 119 ? ? 1_555 O A HOH 119 ? ? 10_444 2.13 12 1 CG A MET 1 ? ? 1_555 CE A MET 1 ? ? 10_444 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 0 ? ? 81.90 109.97 2 1 SER A 58 ? ? 86.18 -28.04 3 1 GLN A 59 ? ? 50.84 18.02 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A GOL 102 ? D GOL . 2 1 A GOL 102 ? D GOL . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 24 ? A GLU 26 2 1 Y 1 A GLY 25 ? A GLY 27 3 1 Y 1 A THR 26 ? A THR 28 4 1 Y 1 A ASP 27 ? A ASP 29 5 1 Y 1 A ASN 28 ? A ASN 30 6 1 Y 1 A GLY 29 ? A GLY 31 7 1 Y 1 A ASP 30 ? A ASP 32 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 MET N N N N 219 MET CA C N S 220 MET C C N N 221 MET O O N N 222 MET CB C N N 223 MET CG C N N 224 MET SD S N N 225 MET CE C N N 226 MET OXT O N N 227 MET H H N N 228 MET H2 H N N 229 MET HA H N N 230 MET HB2 H N N 231 MET HB3 H N N 232 MET HG2 H N N 233 MET HG3 H N N 234 MET HE1 H N N 235 MET HE2 H N N 236 MET HE3 H N N 237 MET HXT H N N 238 PHE N N N N 239 PHE CA C N S 240 PHE C C N N 241 PHE O O N N 242 PHE CB C N N 243 PHE CG C Y N 244 PHE CD1 C Y N 245 PHE CD2 C Y N 246 PHE CE1 C Y N 247 PHE CE2 C Y N 248 PHE CZ C Y N 249 PHE OXT O N N 250 PHE H H N N 251 PHE H2 H N N 252 PHE HA H N N 253 PHE HB2 H N N 254 PHE HB3 H N N 255 PHE HD1 H N N 256 PHE HD2 H N N 257 PHE HE1 H N N 258 PHE HE2 H N N 259 PHE HZ H N N 260 PHE HXT H N N 261 PRO N N N N 262 PRO CA C N S 263 PRO C C N N 264 PRO O O N N 265 PRO CB C N N 266 PRO CG C N N 267 PRO CD C N N 268 PRO OXT O N N 269 PRO H H N N 270 PRO HA H N N 271 PRO HB2 H N N 272 PRO HB3 H N N 273 PRO HG2 H N N 274 PRO HG3 H N N 275 PRO HD2 H N N 276 PRO HD3 H N N 277 PRO HXT H N N 278 SER N N N N 279 SER CA C N S 280 SER C C N N 281 SER O O N N 282 SER CB C N N 283 SER OG O N N 284 SER OXT O N N 285 SER H H N N 286 SER H2 H N N 287 SER HA H N N 288 SER HB2 H N N 289 SER HB3 H N N 290 SER HG H N N 291 SER HXT H N N 292 THR N N N N 293 THR CA C N S 294 THR C C N N 295 THR O O N N 296 THR CB C N R 297 THR OG1 O N N 298 THR CG2 C N N 299 THR OXT O N N 300 THR H H N N 301 THR H2 H N N 302 THR HA H N N 303 THR HB H N N 304 THR HG1 H N N 305 THR HG21 H N N 306 THR HG22 H N N 307 THR HG23 H N N 308 THR HXT H N N 309 VAL N N N N 310 VAL CA C N S 311 VAL C C N N 312 VAL O O N N 313 VAL CB C N N 314 VAL CG1 C N N 315 VAL CG2 C N N 316 VAL OXT O N N 317 VAL H H N N 318 VAL H2 H N N 319 VAL HA H N N 320 VAL HB H N N 321 VAL HG11 H N N 322 VAL HG12 H N N 323 VAL HG13 H N N 324 VAL HG21 H N N 325 VAL HG22 H N N 326 VAL HG23 H N N 327 VAL HXT H N N 328 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 MET N CA sing N N 207 MET N H sing N N 208 MET N H2 sing N N 209 MET CA C sing N N 210 MET CA CB sing N N 211 MET CA HA sing N N 212 MET C O doub N N 213 MET C OXT sing N N 214 MET CB CG sing N N 215 MET CB HB2 sing N N 216 MET CB HB3 sing N N 217 MET CG SD sing N N 218 MET CG HG2 sing N N 219 MET CG HG3 sing N N 220 MET SD CE sing N N 221 MET CE HE1 sing N N 222 MET CE HE2 sing N N 223 MET CE HE3 sing N N 224 MET OXT HXT sing N N 225 PHE N CA sing N N 226 PHE N H sing N N 227 PHE N H2 sing N N 228 PHE CA C sing N N 229 PHE CA CB sing N N 230 PHE CA HA sing N N 231 PHE C O doub N N 232 PHE C OXT sing N N 233 PHE CB CG sing N N 234 PHE CB HB2 sing N N 235 PHE CB HB3 sing N N 236 PHE CG CD1 doub Y N 237 PHE CG CD2 sing Y N 238 PHE CD1 CE1 sing Y N 239 PHE CD1 HD1 sing N N 240 PHE CD2 CE2 doub Y N 241 PHE CD2 HD2 sing N N 242 PHE CE1 CZ doub Y N 243 PHE CE1 HE1 sing N N 244 PHE CE2 CZ sing Y N 245 PHE CE2 HE2 sing N N 246 PHE CZ HZ sing N N 247 PHE OXT HXT sing N N 248 PRO N CA sing N N 249 PRO N CD sing N N 250 PRO N H sing N N 251 PRO CA C sing N N 252 PRO CA CB sing N N 253 PRO CA HA sing N N 254 PRO C O doub N N 255 PRO C OXT sing N N 256 PRO CB CG sing N N 257 PRO CB HB2 sing N N 258 PRO CB HB3 sing N N 259 PRO CG CD sing N N 260 PRO CG HG2 sing N N 261 PRO CG HG3 sing N N 262 PRO CD HD2 sing N N 263 PRO CD HD3 sing N N 264 PRO OXT HXT sing N N 265 SER N CA sing N N 266 SER N H sing N N 267 SER N H2 sing N N 268 SER CA C sing N N 269 SER CA CB sing N N 270 SER CA HA sing N N 271 SER C O doub N N 272 SER C OXT sing N N 273 SER CB OG sing N N 274 SER CB HB2 sing N N 275 SER CB HB3 sing N N 276 SER OG HG sing N N 277 SER OXT HXT sing N N 278 THR N CA sing N N 279 THR N H sing N N 280 THR N H2 sing N N 281 THR CA C sing N N 282 THR CA CB sing N N 283 THR CA HA sing N N 284 THR C O doub N N 285 THR C OXT sing N N 286 THR CB OG1 sing N N 287 THR CB CG2 sing N N 288 THR CB HB sing N N 289 THR OG1 HG1 sing N N 290 THR CG2 HG21 sing N N 291 THR CG2 HG22 sing N N 292 THR CG2 HG23 sing N N 293 THR OXT HXT sing N N 294 VAL N CA sing N N 295 VAL N H sing N N 296 VAL N H2 sing N N 297 VAL CA C sing N N 298 VAL CA CB sing N N 299 VAL CA HA sing N N 300 VAL C O doub N N 301 VAL C OXT sing N N 302 VAL CB CG1 sing N N 303 VAL CB CG2 sing N N 304 VAL CB HB sing N N 305 VAL CG1 HG11 sing N N 306 VAL CG1 HG12 sing N N 307 VAL CG1 HG13 sing N N 308 VAL CG2 HG21 sing N N 309 VAL CG2 HG22 sing N N 310 VAL CG2 HG23 sing N N 311 VAL OXT HXT sing N N 312 # _atom_sites.entry_id 1Y0N _atom_sites.fract_transf_matrix[1][1] 0.012770 _atom_sites.fract_transf_matrix[1][2] 0.007373 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014745 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019044 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ #