data_1Y0N # _entry.id 1Y0N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1Y0N RCSB RCSB030966 WWPDB D_1000030966 # _pdbx_database_related.db_name TARGETDB _pdbx_database_related.db_id apc5056 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Y0N _pdbx_database_status.recvd_initial_deposition_date 2004-11-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Binkowski, T.A.' 1 'Edwards, A.' 2 'Savchenko, A.' 3 'Skarina, T.' 4 'Gorodichtchenskaia, E.' 5 'Joachimiak, A.' 6 'Midwest Center for Structural Genomics (MCSG)' 7 # _citation.id primary _citation.title 'Hypothetical protein PA3463 from Pseudomonas aeruginosa strain PAO1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Binkowski, T.A.' 1 primary 'Edwards, A.' 2 primary 'Savchenko, A.' 3 primary 'Skarina, T.' 4 primary 'Gorodichtchenskaia, E.' 5 primary 'Joachimiak, A.' 6 primary 'Midwest Center for Structural Genomics (MCSG)' 7 # _cell.entry_id 1Y0N _cell.length_a 78.311 _cell.length_b 78.311 _cell.length_c 52.510 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1Y0N _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical UPF0270 protein PA3463' 8902.952 1 ? ? ? ? 2 non-polymer syn GLYCEROL 92.094 4 ? ? ? ? 3 water nat water 18.015 28 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GHMLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD _entity_poly.pdbx_seq_one_letter_code_can GHMLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC5056 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 LEU n 1 5 ILE n 1 6 PRO n 1 7 HIS n 1 8 ASP n 1 9 LEU n 1 10 LEU n 1 11 GLU n 1 12 ALA n 1 13 ASP n 1 14 THR n 1 15 LEU n 1 16 ASN n 1 17 ASN n 1 18 LEU n 1 19 LEU n 1 20 GLU n 1 21 ASP n 1 22 PHE n 1 23 VAL n 1 24 THR n 1 25 ARG n 1 26 GLU n 1 27 GLY n 1 28 THR n 1 29 ASP n 1 30 ASN n 1 31 GLY n 1 32 ASP n 1 33 GLU n 1 34 THR n 1 35 PRO n 1 36 LEU n 1 37 ASP n 1 38 VAL n 1 39 ARG n 1 40 VAL n 1 41 GLU n 1 42 ARG n 1 43 ALA n 1 44 ARG n 1 45 HIS n 1 46 ALA n 1 47 LEU n 1 48 ARG n 1 49 ARG n 1 50 GLY n 1 51 GLU n 1 52 ALA n 1 53 VAL n 1 54 ILE n 1 55 LEU n 1 56 PHE n 1 57 ASP n 1 58 PRO n 1 59 GLU n 1 60 SER n 1 61 GLN n 1 62 GLN n 1 63 CYS n 1 64 GLN n 1 65 LEU n 1 66 MET n 1 67 LEU n 1 68 ARG n 1 69 SER n 1 70 GLU n 1 71 VAL n 1 72 PRO n 1 73 ALA n 1 74 GLU n 1 75 LEU n 1 76 LEU n 1 77 ARG n 1 78 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene PA3463 _entity_src_gen.gene_src_species 'Pseudomonas aeruginosa' _entity_src_gen.gene_src_strain PAO1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y3463_PSEAE _struct_ref.pdbx_db_accession Q9HYE3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLRD _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Y0N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HYE3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1Y0N GLY A 1 ? UNP Q9HYE3 ? ? 'CLONING ARTIFACT' -1 1 1 1Y0N HIS A 2 ? UNP Q9HYE3 ? ? 'CLONING ARTIFACT' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1Y0N _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.81 _exptl_crystal.density_percent_sol 56.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details 'Na Citrate 1.4M, 0.1M Hepes Na, pH 7.5, VAPOR DIFFUSION, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 150 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC-2 _diffrn_detector.pdbx_collection_date 2004-07-21 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength .97945 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list .97945 # _reflns.entry_id 1Y0N _reflns.number_all ? _reflns.number_obs 6791 _reflns.percent_possible_obs ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 28.51 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.002 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1Y0N _refine.ls_number_reflns_obs 6366 _refine.ls_number_reflns_all 6688 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 28.51 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 98.57 _refine.ls_R_factor_obs 0.24761 _refine.ls_R_factor_all 0.24761 _refine.ls_R_factor_R_work 0.24565 _refine.ls_R_factor_R_free 0.28893 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 322 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.936 _refine.correlation_coeff_Fo_to_Fc_free 0.919 _refine.B_iso_mean 42.996 _refine.aniso_B[1][1] -0.12 _refine.aniso_B[2][2] -0.12 _refine.aniso_B[3][3] 0.18 _refine.aniso_B[1][2] -0.06 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.202 _refine.pdbx_overall_ESU_R_Free 0.185 _refine.overall_SU_ML 0.128 _refine.overall_SU_B 8.785 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 574 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 626 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 28.51 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.022 0.021 ? 601 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.075 2.019 ? 805 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.919 5.000 ? 69 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.133 23.438 ? 32 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.117 15.000 ? 106 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 20.833 15.000 ? 8 'X-RAY DIFFRACTION' ? r_chiral_restr 0.140 0.200 ? 92 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.008 0.020 ? 440 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.269 0.200 ? 247 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.300 0.200 ? 389 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.323 0.200 ? 33 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.689 0.200 ? 65 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.509 0.200 ? 9 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.594 1.500 ? 370 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.622 2.000 ? 573 'X-RAY DIFFRACTION' ? r_scbond_it 3.922 3.000 ? 248 'X-RAY DIFFRACTION' ? r_scangle_it 5.607 4.500 ? 232 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.002 _refine_ls_shell.d_res_low 2.053 _refine_ls_shell.number_reflns_R_work 404 _refine_ls_shell.R_factor_R_work 0.399 _refine_ls_shell.percent_reflns_obs 88.91 _refine_ls_shell.R_factor_R_free 0.501 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 1Y0N _struct.title 'Structure of Protein of Unknown Function PA3463 from Pseudomonas aeruginosa PAO1' _struct.pdbx_descriptor 'Hypothetical UPF0270 protein PA3463' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Y0N _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;MCSG, Midwest Center for Structural Genomics, Protein Structure Initiative, PSI, structural genomics, Pseudomonsa aeruginosa, hypothetical protein, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 6 ? LEU A 10 ? PRO A 4 LEU A 8 5 ? 5 HELX_P HELX_P2 2 GLU A 11 ? ARG A 25 ? GLU A 9 ARG A 23 1 ? 15 HELX_P HELX_P3 3 PRO A 35 ? ARG A 49 ? PRO A 33 ARG A 47 1 ? 15 HELX_P HELX_P4 4 SER A 69 ? VAL A 71 ? SER A 67 VAL A 69 5 ? 3 HELX_P HELX_P5 5 PRO A 72 ? LEU A 76 ? PRO A 70 LEU A 74 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ILE 5 O ? ? ? 1_555 B GOL . O2 ? ? A ILE 3 A GOL 101 1_555 ? ? ? ? ? ? ? 1.755 ? covale2 covale ? ? D GOL . O3 ? ? ? 1_555 C GOL . O1 ? ? A GOL 102 A GOL 104 1_555 ? ? ? ? ? ? ? 1.968 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 1 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id -1 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 2 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 0 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -13.04 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 3 ? LEU A 4 ? MET A 1 LEU A 2 A 2 ALA A 52 ? PHE A 56 ? ALA A 50 PHE A 54 A 3 CYS A 63 ? LEU A 67 ? CYS A 61 LEU A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 3 ? N MET A 1 O PHE A 56 ? O PHE A 54 A 2 3 N VAL A 53 ? N VAL A 51 O MET A 66 ? O MET A 64 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 101' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 104' AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 102' AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE GOL A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ILE A 5 ? ILE A 3 . ? 1_555 ? 2 AC1 6 PRO A 6 ? PRO A 4 . ? 1_555 ? 3 AC1 6 HIS A 7 ? HIS A 5 . ? 1_555 ? 4 AC1 6 VAL A 53 ? VAL A 51 . ? 1_555 ? 5 AC1 6 ILE A 54 ? ILE A 52 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 109 . ? 1_555 ? 7 AC2 6 GLU A 51 ? GLU A 49 . ? 1_555 ? 8 AC2 6 SER A 69 ? SER A 67 . ? 7_555 ? 9 AC2 6 GOL D . ? GOL A 102 . ? 1_555 ? 10 AC2 6 GOL D . ? GOL A 102 . ? 7_555 ? 11 AC2 6 HOH F . ? HOH A 116 . ? 7_555 ? 12 AC2 6 HOH F . ? HOH A 118 . ? 1_555 ? 13 AC3 8 GLU A 51 ? GLU A 49 . ? 7_555 ? 14 AC3 8 ARG A 68 ? ARG A 66 . ? 1_555 ? 15 AC3 8 ARG A 68 ? ARG A 66 . ? 7_555 ? 16 AC3 8 SER A 69 ? SER A 67 . ? 1_555 ? 17 AC3 8 SER A 69 ? SER A 67 . ? 7_555 ? 18 AC3 8 GOL C . ? GOL A 104 . ? 1_555 ? 19 AC3 8 GOL C . ? GOL A 104 . ? 7_555 ? 20 AC3 8 HOH F . ? HOH A 106 . ? 7_555 ? 21 AC4 7 HIS A 45 ? HIS A 43 . ? 11_555 ? 22 AC4 7 HIS A 45 ? HIS A 43 . ? 1_555 ? 23 AC4 7 ARG A 49 ? ARG A 47 . ? 11_555 ? 24 AC4 7 PRO A 72 ? PRO A 70 . ? 6_555 ? 25 AC4 7 ALA A 73 ? ALA A 71 . ? 6_555 ? 26 AC4 7 HOH F . ? HOH A 131 . ? 1_555 ? 27 AC4 7 HOH F . ? HOH A 132 . ? 1_555 ? # _database_PDB_matrix.entry_id 1Y0N _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1Y0N _atom_sites.fract_transf_matrix[1][1] 0.012770 _atom_sites.fract_transf_matrix[1][2] 0.007373 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014745 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019044 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 HIS 2 0 0 HIS HIS A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 LEU 4 2 2 LEU LEU A . n A 1 5 ILE 5 3 3 ILE ILE A . n A 1 6 PRO 6 4 4 PRO PRO A . n A 1 7 HIS 7 5 5 HIS HIS A . n A 1 8 ASP 8 6 6 ASP ASP A . n A 1 9 LEU 9 7 7 LEU LEU A . n A 1 10 LEU 10 8 8 LEU LEU A . n A 1 11 GLU 11 9 9 GLU GLU A . n A 1 12 ALA 12 10 10 ALA ALA A . n A 1 13 ASP 13 11 11 ASP ASP A . n A 1 14 THR 14 12 12 THR THR A . n A 1 15 LEU 15 13 13 LEU LEU A . n A 1 16 ASN 16 14 14 ASN ASN A . n A 1 17 ASN 17 15 15 ASN ASN A . n A 1 18 LEU 18 16 16 LEU LEU A . n A 1 19 LEU 19 17 17 LEU LEU A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 ASP 21 19 19 ASP ASP A . n A 1 22 PHE 22 20 20 PHE PHE A . n A 1 23 VAL 23 21 21 VAL VAL A . n A 1 24 THR 24 22 22 THR THR A . n A 1 25 ARG 25 23 23 ARG ARG A . n A 1 26 GLU 26 24 ? ? ? A . n A 1 27 GLY 27 25 ? ? ? A . n A 1 28 THR 28 26 ? ? ? A . n A 1 29 ASP 29 27 ? ? ? A . n A 1 30 ASN 30 28 ? ? ? A . n A 1 31 GLY 31 29 ? ? ? A . n A 1 32 ASP 32 30 ? ? ? A . n A 1 33 GLU 33 31 31 GLU GLU A . n A 1 34 THR 34 32 32 THR THR A . n A 1 35 PRO 35 33 33 PRO PRO A . n A 1 36 LEU 36 34 34 LEU LEU A . n A 1 37 ASP 37 35 35 ASP ASP A . n A 1 38 VAL 38 36 36 VAL VAL A . n A 1 39 ARG 39 37 37 ARG ARG A . n A 1 40 VAL 40 38 38 VAL VAL A . n A 1 41 GLU 41 39 39 GLU GLU A . n A 1 42 ARG 42 40 40 ARG ARG A . n A 1 43 ALA 43 41 41 ALA ALA A . n A 1 44 ARG 44 42 42 ARG ARG A . n A 1 45 HIS 45 43 43 HIS HIS A . n A 1 46 ALA 46 44 44 ALA ALA A . n A 1 47 LEU 47 45 45 LEU LEU A . n A 1 48 ARG 48 46 46 ARG ARG A . n A 1 49 ARG 49 47 47 ARG ARG A . n A 1 50 GLY 50 48 48 GLY GLY A . n A 1 51 GLU 51 49 49 GLU GLU A . n A 1 52 ALA 52 50 50 ALA ALA A . n A 1 53 VAL 53 51 51 VAL VAL A . n A 1 54 ILE 54 52 52 ILE ILE A . n A 1 55 LEU 55 53 53 LEU LEU A . n A 1 56 PHE 56 54 54 PHE PHE A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 PRO 58 56 56 PRO PRO A . n A 1 59 GLU 59 57 57 GLU GLU A . n A 1 60 SER 60 58 58 SER SER A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 GLN 62 60 60 GLN GLN A . n A 1 63 CYS 63 61 61 CYS CYS A . n A 1 64 GLN 64 62 62 GLN GLN A . n A 1 65 LEU 65 63 63 LEU LEU A . n A 1 66 MET 66 64 64 MET MET A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 ARG 68 66 66 ARG ARG A . n A 1 69 SER 69 67 67 SER SER A . n A 1 70 GLU 70 68 68 GLU GLU A . n A 1 71 VAL 71 69 69 VAL VAL A . n A 1 72 PRO 72 70 70 PRO PRO A . n A 1 73 ALA 73 71 71 ALA ALA A . n A 1 74 GLU 74 72 72 GLU GLU A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 LEU 76 74 74 LEU LEU A . n A 1 77 ARG 77 75 75 ARG ARG A . n A 1 78 ASP 78 76 76 ASP ASP A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 101 1 GOL GOL A . C 2 GOL 1 104 4 GOL GOL A . D 2 GOL 1 102 2 GOL GOL A . E 2 GOL 1 103 3 GOL GOL A . F 3 HOH 1 105 1 HOH HOH A . F 3 HOH 2 106 2 HOH HOH A . F 3 HOH 3 107 3 HOH HOH A . F 3 HOH 4 108 4 HOH HOH A . F 3 HOH 5 109 5 HOH HOH A . F 3 HOH 6 110 11 HOH HOH A . F 3 HOH 7 111 12 HOH HOH A . F 3 HOH 8 112 14 HOH HOH A . F 3 HOH 9 113 17 HOH HOH A . F 3 HOH 10 114 19 HOH HOH A . F 3 HOH 11 115 20 HOH HOH A . F 3 HOH 12 116 21 HOH HOH A . F 3 HOH 13 117 25 HOH HOH A . F 3 HOH 14 118 28 HOH HOH A . F 3 HOH 15 119 30 HOH HOH A . F 3 HOH 16 120 31 HOH HOH A . F 3 HOH 17 121 32 HOH HOH A . F 3 HOH 18 122 33 HOH HOH A . F 3 HOH 19 123 37 HOH HOH A . F 3 HOH 20 124 39 HOH HOH A . F 3 HOH 21 125 40 HOH HOH A . F 3 HOH 22 126 42 HOH HOH A . F 3 HOH 23 127 43 HOH HOH A . F 3 HOH 24 128 47 HOH HOH A . F 3 HOH 25 129 49 HOH HOH A . F 3 HOH 26 130 57 HOH HOH A . F 3 HOH 27 131 65 HOH HOH A . F 3 HOH 28 132 68 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A GOL 102 ? D GOL . 2 1 A GOL 102 ? D GOL . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-12-21 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 HKL-2000 'data reduction' . ? 2 HKL-2000 'data scaling' . ? 3 SHARP phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GOL _pdbx_validate_close_contact.auth_seq_id_1 103 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 132 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.96 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 SD A MET 1 ? ? 1_555 CE A MET 1 ? ? 10_444 0.56 2 1 O1 A GOL 102 ? ? 1_555 C3 A GOL 102 ? ? 7_555 1.35 3 1 C1 A GOL 102 ? ? 1_555 C2 A GOL 102 ? ? 7_555 1.49 4 1 C1 A GOL 102 ? ? 1_555 C3 A GOL 102 ? ? 7_555 1.58 5 1 SD A MET 1 ? ? 1_555 SD A MET 1 ? ? 10_444 1.65 6 1 C2 A GOL 102 ? ? 1_555 C3 A GOL 102 ? ? 7_555 1.70 7 1 CE A MET 1 ? ? 1_555 CE A MET 1 ? ? 10_444 1.76 8 1 N A GLY -1 ? ? 1_555 OD1 A ASP 35 ? ? 5_554 1.83 9 1 C1 A GOL 102 ? ? 1_555 O3 A GOL 102 ? ? 7_555 1.89 10 1 O1 A GOL 102 ? ? 1_555 O3 A GOL 102 ? ? 7_555 1.92 11 1 O A HOH 119 ? ? 1_555 O A HOH 119 ? ? 10_444 2.13 12 1 CG A MET 1 ? ? 1_555 CE A MET 1 ? ? 10_444 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 0 ? ? 81.90 109.97 2 1 SER A 58 ? ? 86.18 -28.04 3 1 GLN A 59 ? ? 50.84 18.02 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 24 ? A GLU 26 2 1 Y 1 A GLY 25 ? A GLY 27 3 1 Y 1 A THR 26 ? A THR 28 4 1 Y 1 A ASP 27 ? A ASP 29 5 1 Y 1 A ASN 28 ? A ASN 30 6 1 Y 1 A GLY 29 ? A GLY 31 7 1 Y 1 A ASP 30 ? A ASP 32 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH #