data_1YAB # _entry.id 1YAB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YAB pdb_00001yab 10.2210/pdb1yab/pdb RCSB RCSB031313 ? ? WWPDB D_1000031313 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1O6A _pdbx_database_related.details 'T. maritima FliN' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YAB _pdbx_database_status.recvd_initial_deposition_date 2004-12-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hill, C.P.' 1 ? 'Blair, D.F.' 2 ? 'Brown, P.N.' 3 ? 'Mathews, M.A.A.' 4 ? 'Joss, L.A.' 5 ? # _citation.id primary _citation.title 'Crystal Structure of the Flagellar Rotor Protein FliN from Thermotoga maritima' _citation.journal_abbrev J.BACTERIOL. _citation.journal_volume 187 _citation.page_first 2890 _citation.page_last 2902 _citation.year 2005 _citation.journal_id_ASTM JOBAAY _citation.country US _citation.journal_id_ISSN 0021-9193 _citation.journal_id_CSD 0767 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15805535 _citation.pdbx_database_id_DOI 10.1128/JB.187.8.2890-2902.2005 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brown, P.N.' 1 ? primary 'Mathews, M.A.A.' 2 ? primary 'Joss, L.A.' 3 ? primary 'Hill, C.P.' 4 ? primary 'Blair, D.F.' 5 ? # _cell.entry_id 1YAB _cell.length_a 100.173 _cell.length_b 100.173 _cell.length_c 87.853 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1YAB _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'chemotaxis protein' _entity.formula_weight 9800.546 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 68-154' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name FliN # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKE RLELLNE ; _entity_poly.pdbx_seq_one_letter_code_can ;SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKE RLELLNE ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 LYS n 1 4 LEU n 1 5 GLU n 1 6 LEU n 1 7 LEU n 1 8 LEU n 1 9 ASP n 1 10 ILE n 1 11 PRO n 1 12 LEU n 1 13 LYS n 1 14 VAL n 1 15 THR n 1 16 VAL n 1 17 GLU n 1 18 LEU n 1 19 GLY n 1 20 ARG n 1 21 THR n 1 22 ARG n 1 23 MET n 1 24 THR n 1 25 LEU n 1 26 LYS n 1 27 ARG n 1 28 VAL n 1 29 LEU n 1 30 GLU n 1 31 MET n 1 32 ILE n 1 33 HIS n 1 34 GLY n 1 35 SER n 1 36 ILE n 1 37 ILE n 1 38 GLU n 1 39 LEU n 1 40 ASP n 1 41 LYS n 1 42 LEU n 1 43 THR n 1 44 GLY n 1 45 GLU n 1 46 PRO n 1 47 VAL n 1 48 ASP n 1 49 ILE n 1 50 LEU n 1 51 VAL n 1 52 ASN n 1 53 GLY n 1 54 LYS n 1 55 LEU n 1 56 ILE n 1 57 ALA n 1 58 ARG n 1 59 GLY n 1 60 GLU n 1 61 VAL n 1 62 VAL n 1 63 VAL n 1 64 ILE n 1 65 ASP n 1 66 GLU n 1 67 ASN n 1 68 PHE n 1 69 GLY n 1 70 VAL n 1 71 ARG n 1 72 ILE n 1 73 THR n 1 74 GLU n 1 75 ILE n 1 76 VAL n 1 77 SER n 1 78 PRO n 1 79 LYS n 1 80 GLU n 1 81 ARG n 1 82 LEU n 1 83 GLU n 1 84 LEU n 1 85 LEU n 1 86 ASN n 1 87 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermotoga _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Thermotoga maritima' _entity_src_gen.gene_src_strain MSB8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code NP_228489 _struct_ref.pdbx_db_accession 15644624 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIPGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKE RLELLNE ; _struct_ref.pdbx_align_begin 68 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1YAB A 1 ? 87 ? 15644624 68 ? 154 ? 68 154 2 1 1YAB B 1 ? 87 ? 15644624 68 ? 154 ? 68 154 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1YAB HIS A 33 ? GB 15644624 PRO 100 'SEE REMARK 999' 100 1 2 1YAB HIS B 33 ? GB 15644624 PRO 100 'SEE REMARK 999' 100 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1YAB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.7 _exptl_crystal.density_percent_sol 70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.9 _exptl_crystal_grow.pdbx_details '18% MPD, 100mM MES buffer, pH 5.9, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2003-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979277 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.979277 # _reflns.entry_id 1YAB _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.d_resolution_high 3.4 _reflns.d_resolution_low 87.7 _reflns.number_all 7246 _reflns.number_obs 7246 _reflns.percent_possible_obs 95.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.07 _reflns.pdbx_netI_over_sigmaI 7.3 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.4 _reflns_shell.d_res_low 3.52 _reflns_shell.percent_possible_all 93.4 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.289 _reflns_shell.meanI_over_sigI_obs 1.8 _reflns_shell.pdbx_redundancy 11 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 996 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1YAB _refine.ls_number_reflns_obs 6906 _refine.ls_number_reflns_all 7246 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.90 _refine.ls_d_res_high 3.40 _refine.ls_percent_reflns_obs 99.04 _refine.ls_R_factor_obs 0.22735 _refine.ls_R_factor_all 0.22735 _refine.ls_R_factor_R_work 0.22437 _refine.ls_R_factor_R_free 0.28624 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.7 _refine.ls_number_reflns_R_free 340 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.945 _refine.correlation_coeff_Fo_to_Fc_free 0.904 _refine.B_iso_mean 112.247 _refine.aniso_B[1][1] 6.52 _refine.aniso_B[2][2] 6.52 _refine.aniso_B[3][3] -9.78 _refine.aniso_B[1][2] 3.26 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 1O6A.pdb _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.738 _refine.pdbx_overall_ESU_R_Free 0.439 _refine.overall_SU_ML 0.373 _refine.overall_SU_B 24.248 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1352 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1352 _refine_hist.d_res_high 3.40 _refine_hist.d_res_low 19.90 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.014 0.022 ? 1360 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.760 2.025 ? 1834 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 8.738 5.000 ? 170 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 45.642 24.510 ? 51 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 23.970 15.000 ? 289 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 17.903 15.000 ? 12 'X-RAY DIFFRACTION' ? r_chiral_restr 0.119 0.200 ? 238 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.020 ? 934 'X-RAY DIFFRACTION' ? r_nbd_refined 0.264 0.200 ? 637 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.326 0.200 ? 924 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.180 0.200 ? 39 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.261 0.200 ? 22 'X-RAY DIFFRACTION' ? r_mcbond_it 0.746 1.500 ? 876 'X-RAY DIFFRACTION' ? r_mcangle_it 1.396 2.000 ? 1400 'X-RAY DIFFRACTION' ? r_scbond_it 1.708 3.000 ? 511 'X-RAY DIFFRACTION' ? r_scangle_it 3.353 4.500 ? 434 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight 1 'medium positional' A 668 0.71 0.50 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? 1 'medium thermal' A 668 0.42 2.00 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 3.397 _refine_ls_shell.d_res_low 3.581 _refine_ls_shell.number_reflns_R_work 996 _refine_ls_shell.R_factor_R_work 0.337 _refine_ls_shell.percent_reflns_obs 99.71 _refine_ls_shell.R_factor_R_free 0.417 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 53 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 A 1 2 B # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A SER 1 . A LEU 85 . A SER 68 A LEU 152 4 ? 1 2 1 B SER 1 . B LEU 85 . B SER 68 B LEU 152 4 ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? _struct_ncs_ens.point_group ? # _struct.entry_id 1YAB _struct.title 'Structure of T. maritima FliN flagellar rotor protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YAB _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'Thermotoga maritima, flagellar motor, rotor, FliN, FliY, STRUCTURAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details ;Two molecules of FliN constructu containing residues 68 to 154 form the asymmetric unit. The two monomers interact over a large surface, with intertwined elements, each forming a saddle shape that interlocks with the other. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? LEU A 8 ? ASP A 69 LEU A 75 1 ? 7 HELX_P HELX_P2 2 THR A 24 ? MET A 31 ? THR A 91 MET A 98 1 ? 8 HELX_P HELX_P3 3 LYS A 79 ? LEU A 84 ? LYS A 146 LEU A 151 1 ? 6 HELX_P HELX_P4 4 LEU B 4 ? ASP B 9 ? LEU B 71 ASP B 76 1 ? 6 HELX_P HELX_P5 5 LYS B 26 ? GLU B 30 ? LYS B 93 GLU B 97 5 ? 5 HELX_P HELX_P6 6 SER B 77 ? ASN B 86 ? SER B 144 ASN B 153 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 86 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 153 _struct_mon_prot_cis.auth_asym_id B _struct_mon_prot_cis.pdbx_label_comp_id_2 GLU _struct_mon_prot_cis.pdbx_label_seq_id_2 87 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLU _struct_mon_prot_cis.pdbx_auth_seq_id_2 154 _struct_mon_prot_cis.pdbx_auth_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -7.39 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 36 ? GLU A 38 ? ILE A 103 GLU A 105 A 2 ASN B 67 ? ILE B 75 ? ASN B 134 ILE B 142 A 3 LYS B 54 ? ILE B 64 ? LYS B 121 ILE B 131 A 4 VAL B 47 ? VAL B 51 ? VAL B 114 VAL B 118 A 5 VAL B 14 ? THR B 24 ? VAL B 81 THR B 91 A 6 PRO A 11 ? GLY A 19 ? PRO A 78 GLY A 86 A 7 VAL A 47 ? VAL A 51 ? VAL A 114 VAL A 118 A 8 LYS A 54 ? ILE A 64 ? LYS A 121 ILE A 131 A 9 ASN A 67 ? ILE A 75 ? ASN A 134 ILE A 142 A 10 ILE B 36 ? LEU B 42 ? ILE B 103 LEU B 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 37 ? N ILE A 104 O VAL B 70 ? O VAL B 137 A 2 3 O GLY B 69 ? O GLY B 136 N VAL B 62 ? N VAL B 129 A 3 4 O ALA B 57 ? O ALA B 124 N ILE B 49 ? N ILE B 116 A 4 5 O LEU B 50 ? O LEU B 117 N THR B 15 ? N THR B 82 A 5 6 O LEU B 18 ? O LEU B 85 N VAL A 16 ? N VAL A 83 A 6 7 N THR A 15 ? N THR A 82 O LEU A 50 ? O LEU A 117 A 7 8 N VAL A 47 ? N VAL A 114 O GLY A 59 ? O GLY A 126 A 8 9 N GLU A 60 ? N GLU A 127 O ARG A 71 ? O ARG A 138 A 9 10 N VAL A 70 ? N VAL A 137 O ILE B 37 ? O ILE B 104 # _database_PDB_matrix.entry_id 1YAB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1YAB _atom_sites.fract_transf_matrix[1][1] 0.009983 _atom_sites.fract_transf_matrix[1][2] 0.005764 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011527 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011383 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 68 68 SER SER A . n A 1 2 ASP 2 69 69 ASP ASP A . n A 1 3 LYS 3 70 70 LYS LYS A . n A 1 4 LEU 4 71 71 LEU LEU A . n A 1 5 GLU 5 72 72 GLU GLU A . n A 1 6 LEU 6 73 73 LEU LEU A . n A 1 7 LEU 7 74 74 LEU LEU A . n A 1 8 LEU 8 75 75 LEU LEU A . n A 1 9 ASP 9 76 76 ASP ASP A . n A 1 10 ILE 10 77 77 ILE ILE A . n A 1 11 PRO 11 78 78 PRO PRO A . n A 1 12 LEU 12 79 79 LEU LEU A . n A 1 13 LYS 13 80 80 LYS LYS A . n A 1 14 VAL 14 81 81 VAL VAL A . n A 1 15 THR 15 82 82 THR THR A . n A 1 16 VAL 16 83 83 VAL VAL A . n A 1 17 GLU 17 84 84 GLU GLU A . n A 1 18 LEU 18 85 85 LEU LEU A . n A 1 19 GLY 19 86 86 GLY GLY A . n A 1 20 ARG 20 87 87 ARG ARG A . n A 1 21 THR 21 88 88 THR THR A . n A 1 22 ARG 22 89 89 ARG ARG A . n A 1 23 MET 23 90 90 MET MET A . n A 1 24 THR 24 91 91 THR THR A . n A 1 25 LEU 25 92 92 LEU LEU A . n A 1 26 LYS 26 93 93 LYS LYS A . n A 1 27 ARG 27 94 94 ARG ARG A . n A 1 28 VAL 28 95 95 VAL VAL A . n A 1 29 LEU 29 96 96 LEU LEU A . n A 1 30 GLU 30 97 97 GLU GLU A . n A 1 31 MET 31 98 98 MET MET A . n A 1 32 ILE 32 99 99 ILE ILE A . n A 1 33 HIS 33 100 100 HIS HIS A . n A 1 34 GLY 34 101 101 GLY GLY A . n A 1 35 SER 35 102 102 SER SER A . n A 1 36 ILE 36 103 103 ILE ILE A . n A 1 37 ILE 37 104 104 ILE ILE A . n A 1 38 GLU 38 105 105 GLU GLU A . n A 1 39 LEU 39 106 106 LEU LEU A . n A 1 40 ASP 40 107 107 ASP ASP A . n A 1 41 LYS 41 108 108 LYS LYS A . n A 1 42 LEU 42 109 109 LEU LEU A . n A 1 43 THR 43 110 110 THR THR A . n A 1 44 GLY 44 111 111 GLY GLY A . n A 1 45 GLU 45 112 112 GLU GLU A . n A 1 46 PRO 46 113 113 PRO PRO A . n A 1 47 VAL 47 114 114 VAL VAL A . n A 1 48 ASP 48 115 115 ASP ASP A . n A 1 49 ILE 49 116 116 ILE ILE A . n A 1 50 LEU 50 117 117 LEU LEU A . n A 1 51 VAL 51 118 118 VAL VAL A . n A 1 52 ASN 52 119 119 ASN ASN A . n A 1 53 GLY 53 120 120 GLY GLY A . n A 1 54 LYS 54 121 121 LYS LYS A . n A 1 55 LEU 55 122 122 LEU LEU A . n A 1 56 ILE 56 123 123 ILE ILE A . n A 1 57 ALA 57 124 124 ALA ALA A . n A 1 58 ARG 58 125 125 ARG ARG A . n A 1 59 GLY 59 126 126 GLY GLY A . n A 1 60 GLU 60 127 127 GLU GLU A . n A 1 61 VAL 61 128 128 VAL VAL A . n A 1 62 VAL 62 129 129 VAL VAL A . n A 1 63 VAL 63 130 130 VAL VAL A . n A 1 64 ILE 64 131 131 ILE ILE A . n A 1 65 ASP 65 132 132 ASP ASP A . n A 1 66 GLU 66 133 133 GLU GLU A . n A 1 67 ASN 67 134 134 ASN ASN A . n A 1 68 PHE 68 135 135 PHE PHE A . n A 1 69 GLY 69 136 136 GLY GLY A . n A 1 70 VAL 70 137 137 VAL VAL A . n A 1 71 ARG 71 138 138 ARG ARG A . n A 1 72 ILE 72 139 139 ILE ILE A . n A 1 73 THR 73 140 140 THR THR A . n A 1 74 GLU 74 141 141 GLU GLU A . n A 1 75 ILE 75 142 142 ILE ILE A . n A 1 76 VAL 76 143 143 VAL VAL A . n A 1 77 SER 77 144 144 SER SER A . n A 1 78 PRO 78 145 145 PRO PRO A . n A 1 79 LYS 79 146 146 LYS LYS A . n A 1 80 GLU 80 147 147 GLU GLU A . n A 1 81 ARG 81 148 148 ARG ARG A . n A 1 82 LEU 82 149 149 LEU LEU A . n A 1 83 GLU 83 150 150 GLU GLU A . n A 1 84 LEU 84 151 151 LEU LEU A . n A 1 85 LEU 85 152 152 LEU LEU A . n A 1 86 ASN 86 153 ? ? ? A . n A 1 87 GLU 87 154 ? ? ? A . n B 1 1 SER 1 68 68 SER SER B . n B 1 2 ASP 2 69 69 ASP ASP B . n B 1 3 LYS 3 70 70 LYS LYS B . n B 1 4 LEU 4 71 71 LEU LEU B . n B 1 5 GLU 5 72 72 GLU GLU B . n B 1 6 LEU 6 73 73 LEU LEU B . n B 1 7 LEU 7 74 74 LEU LEU B . n B 1 8 LEU 8 75 75 LEU LEU B . n B 1 9 ASP 9 76 76 ASP ASP B . n B 1 10 ILE 10 77 77 ILE ILE B . n B 1 11 PRO 11 78 78 PRO PRO B . n B 1 12 LEU 12 79 79 LEU LEU B . n B 1 13 LYS 13 80 80 LYS LYS B . n B 1 14 VAL 14 81 81 VAL VAL B . n B 1 15 THR 15 82 82 THR THR B . n B 1 16 VAL 16 83 83 VAL VAL B . n B 1 17 GLU 17 84 84 GLU GLU B . n B 1 18 LEU 18 85 85 LEU LEU B . n B 1 19 GLY 19 86 86 GLY GLY B . n B 1 20 ARG 20 87 87 ARG ARG B . n B 1 21 THR 21 88 88 THR THR B . n B 1 22 ARG 22 89 89 ARG ARG B . n B 1 23 MET 23 90 90 MET MET B . n B 1 24 THR 24 91 91 THR THR B . n B 1 25 LEU 25 92 92 LEU LEU B . n B 1 26 LYS 26 93 93 LYS LYS B . n B 1 27 ARG 27 94 94 ARG ARG B . n B 1 28 VAL 28 95 95 VAL VAL B . n B 1 29 LEU 29 96 96 LEU LEU B . n B 1 30 GLU 30 97 97 GLU GLU B . n B 1 31 MET 31 98 98 MET MET B . n B 1 32 ILE 32 99 99 ILE ILE B . n B 1 33 HIS 33 100 100 HIS HIS B . n B 1 34 GLY 34 101 101 GLY GLY B . n B 1 35 SER 35 102 102 SER SER B . n B 1 36 ILE 36 103 103 ILE ILE B . n B 1 37 ILE 37 104 104 ILE ILE B . n B 1 38 GLU 38 105 105 GLU GLU B . n B 1 39 LEU 39 106 106 LEU LEU B . n B 1 40 ASP 40 107 107 ASP ASP B . n B 1 41 LYS 41 108 108 LYS LYS B . n B 1 42 LEU 42 109 109 LEU LEU B . n B 1 43 THR 43 110 110 THR THR B . n B 1 44 GLY 44 111 111 GLY GLY B . n B 1 45 GLU 45 112 112 GLU GLU B . n B 1 46 PRO 46 113 113 PRO PRO B . n B 1 47 VAL 47 114 114 VAL VAL B . n B 1 48 ASP 48 115 115 ASP ASP B . n B 1 49 ILE 49 116 116 ILE ILE B . n B 1 50 LEU 50 117 117 LEU LEU B . n B 1 51 VAL 51 118 118 VAL VAL B . n B 1 52 ASN 52 119 119 ASN ASN B . n B 1 53 GLY 53 120 120 GLY GLY B . n B 1 54 LYS 54 121 121 LYS LYS B . n B 1 55 LEU 55 122 122 LEU LEU B . n B 1 56 ILE 56 123 123 ILE ILE B . n B 1 57 ALA 57 124 124 ALA ALA B . n B 1 58 ARG 58 125 125 ARG ARG B . n B 1 59 GLY 59 126 126 GLY GLY B . n B 1 60 GLU 60 127 127 GLU GLU B . n B 1 61 VAL 61 128 128 VAL VAL B . n B 1 62 VAL 62 129 129 VAL VAL B . n B 1 63 VAL 63 130 130 VAL VAL B . n B 1 64 ILE 64 131 131 ILE ILE B . n B 1 65 ASP 65 132 132 ASP ASP B . n B 1 66 GLU 66 133 133 GLU GLU B . n B 1 67 ASN 67 134 134 ASN ASN B . n B 1 68 PHE 68 135 135 PHE PHE B . n B 1 69 GLY 69 136 136 GLY GLY B . n B 1 70 VAL 70 137 137 VAL VAL B . n B 1 71 ARG 71 138 138 ARG ARG B . n B 1 72 ILE 72 139 139 ILE ILE B . n B 1 73 THR 73 140 140 THR THR B . n B 1 74 GLU 74 141 141 GLU GLU B . n B 1 75 ILE 75 142 142 ILE ILE B . n B 1 76 VAL 76 143 143 VAL VAL B . n B 1 77 SER 77 144 144 SER SER B . n B 1 78 PRO 78 145 145 PRO PRO B . n B 1 79 LYS 79 146 146 LYS LYS B . n B 1 80 GLU 80 147 147 GLU GLU B . n B 1 81 ARG 81 148 148 ARG ARG B . n B 1 82 LEU 82 149 149 LEU LEU B . n B 1 83 GLU 83 150 150 GLU GLU B . n B 1 84 LEU 84 151 151 LEU LEU B . n B 1 85 LEU 85 152 152 LEU LEU B . n B 1 86 ASN 86 153 153 ASN ASN B . n B 1 87 GLU 87 154 154 GLU GLU B . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 software_defined_assembly PISA,PQS tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A 2 1 B 3 1,2 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 3 'ABSA (A^2)' 13430 ? 3 MORE -97 ? 3 'SSA (A^2)' 16490 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 58.5686666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-06-07 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-02-07 5 'Structure model' 1 4 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Version format compliance' 5 4 'Structure model' 'Experimental preparation' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 5 'Structure model' chem_comp_atom 3 5 'Structure model' chem_comp_bond 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_initial_refinement_model 6 5 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.pdbx_details' 2 4 'Structure model' '_exptl_crystal_grow.temp' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 6 5 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement 5.2.0005 ? 1 ? ? ? ? DENZO 'data reduction' . ? 2 ? ? ? ? SCALEPACK 'data scaling' . ? 3 ? ? ? ? AMoRE phasing . ? 4 ? ? ? ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 69 ? ? CG A ASP 69 ? ? OD2 A ASP 69 ? ? 123.91 118.30 5.61 0.90 N 2 1 CB B ASP 69 ? ? CG B ASP 69 ? ? OD2 B ASP 69 ? ? 123.74 118.30 5.44 0.90 N 3 1 CB B ASP 107 ? ? CG B ASP 107 ? ? OD2 B ASP 107 ? ? 123.84 118.30 5.54 0.90 N 4 1 CB B ASP 115 ? ? CG B ASP 115 ? ? OD2 B ASP 115 ? ? 124.91 118.30 6.61 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 72 ? ? -46.76 -71.65 2 1 LEU A 73 ? ? -29.27 -37.38 3 1 LEU A 75 ? ? -62.58 41.38 4 1 ASP A 76 ? ? -172.46 -4.36 5 1 THR A 88 ? ? 159.24 156.04 6 1 MET A 90 ? ? -176.80 108.38 7 1 THR A 91 ? ? -37.30 124.79 8 1 ASN A 119 ? ? 39.04 64.91 9 1 ASP A 132 ? ? 35.07 -75.21 10 1 PRO A 145 ? ? -61.03 19.72 11 1 LYS A 146 ? ? -98.94 -67.83 12 1 LEU B 73 ? ? -38.92 -18.81 13 1 LEU B 75 ? ? -46.65 -15.32 14 1 ARG B 87 ? ? 178.99 116.23 15 1 HIS B 100 ? ? -35.76 119.80 16 1 ASP B 132 ? ? 53.95 -79.49 17 1 PHE B 135 ? ? 60.07 81.33 18 1 GLU B 150 ? ? -61.44 -82.43 19 1 LEU B 152 ? ? -74.56 -90.33 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LEU A 75 ? ? ASP A 76 ? ? -147.92 2 1 ASP B 69 ? ? LYS B 70 ? ? 148.78 3 1 ASN B 134 ? ? PHE B 135 ? ? 50.70 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B ASN 153 ? OD1 ? B ASN 86 OD1 2 1 Y 1 B ASN 153 ? ND2 ? B ASN 86 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 153 ? A ASN 86 2 1 Y 1 A GLU 154 ? A GLU 87 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 VAL N N N N 284 VAL CA C N S 285 VAL C C N N 286 VAL O O N N 287 VAL CB C N N 288 VAL CG1 C N N 289 VAL CG2 C N N 290 VAL OXT O N N 291 VAL H H N N 292 VAL H2 H N N 293 VAL HA H N N 294 VAL HB H N N 295 VAL HG11 H N N 296 VAL HG12 H N N 297 VAL HG13 H N N 298 VAL HG21 H N N 299 VAL HG22 H N N 300 VAL HG23 H N N 301 VAL HXT H N N 302 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 VAL N CA sing N N 272 VAL N H sing N N 273 VAL N H2 sing N N 274 VAL CA C sing N N 275 VAL CA CB sing N N 276 VAL CA HA sing N N 277 VAL C O doub N N 278 VAL C OXT sing N N 279 VAL CB CG1 sing N N 280 VAL CB CG2 sing N N 281 VAL CB HB sing N N 282 VAL CG1 HG11 sing N N 283 VAL CG1 HG12 sing N N 284 VAL CG1 HG13 sing N N 285 VAL CG2 HG21 sing N N 286 VAL CG2 HG22 sing N N 287 VAL CG2 HG23 sing N N 288 VAL OXT HXT sing N N 289 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1O6A _pdbx_initial_refinement_model.details 1O6A.pdb #