data_1YBZ # _entry.id 1YBZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YBZ pdb_00001ybz 10.2210/pdb1ybz/pdb RCSB RCSB031360 ? ? WWPDB D_1000031360 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-02-01 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 5 'Structure model' 1 4 2024-02-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' chem_comp_atom 3 5 'Structure model' chem_comp_bond 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_database_related 6 5 'Structure model' struct_ref_seq_dif 7 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' 10 5 'Structure model' '_database_2.pdbx_DOI' 11 5 'Structure model' '_database_2.pdbx_database_accession' 12 5 'Structure model' '_pdbx_database_related.db_name' 13 5 'Structure model' '_struct_ref_seq_dif.details' 14 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 15 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 16 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 1YBZ _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2004-12-21 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id Pfu-1581948-001 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, D.' 1 'Chen, L.' 2 'Nguyen, D.' 3 'Dillard, B.D.' 4 'Tempel, W.' 5 'Habel, J.' 6 'Zhou, W.' 7 'Chang, S.-H.' 8 'Kelley, L.-L.C.' 9 'Liu, Z.-J.' 10 'Lin, D.' 11 'Zhang, H.' 12 'Praissman, J.' 13 'Bridger, S.' 14 'Eneh, J.C.' 15 'Hopkins, R.C.' 16 'Jenney Jr., F.E.' 17 'Lee, H.-S.' 18 'Li, T.' 19 'Poole II, F.L.' 20 'Shah, C.' 21 'Sugar, F.J.' 22 'Adams, M.W.W.' 23 'Rose, J.P.' 24 'Wang, B.-C.' 25 'Southeast Collaboratory for Structural Genomics (SECSG)' 26 # _citation.id primary _citation.title 'Conserved hypothetical protein from Pyrococcus furiosus Pfu-1581948-001' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, D.' 1 ? primary 'Chen, L.' 2 ? primary 'Nguyen, D.' 3 ? primary 'Dillard, B.D.' 4 ? primary 'Tempel, W.' 5 ? primary 'Habel, J.' 6 ? primary 'Zhou, W.' 7 ? primary 'Chang, S.-H.' 8 ? primary 'Kelley, L.-L.C.' 9 ? primary 'Liu, Z.-J.' 10 ? primary 'Lin, D.' 11 ? primary 'Zhang, H.' 12 ? primary 'Praissman, J.' 13 ? primary 'Bridger, S.' 14 ? primary 'Eneh, J.C.' 15 ? primary 'Hopkins, R.C.' 16 ? primary 'Jenney Jr., F.E.' 17 ? primary 'Lee, H.-S.' 18 ? primary 'Li, T.' 19 ? primary 'Poole II, F.L.' 20 ? primary 'Shah, C.' 21 ? primary 'Sugar, F.J.' 22 ? primary 'Adams, M.W.W.' 23 ? primary 'Rose, J.P.' 24 ? primary 'Wang, B.-C.' 25 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'chorismate mutase' 10868.622 1 5.4.99.5 ? ? ? 2 non-polymer syn 'UNKNOWN ATOM OR ION' ? 3 ? ? ? ? 3 water nat water 18.015 61 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AHHHHHHENLYFQAGSTTLKLLRKEIDKIDNQIISLLKKRLEIAQAIGKIKKELNLPIEDRKREEEVLRRAGEFREIFEK ILEVSKDVQRL ; _entity_poly.pdbx_seq_one_letter_code_can ;AHHHHHHENLYFQAGSTTLKLLRKEIDKIDNQIISLLKKRLEIAQAIGKIKKELNLPIEDRKREEEVLRRAGEFREIFEK ILEVSKDVQRL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier Pfu-1581948-001 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'UNKNOWN ATOM OR ION' UNX 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLU n 1 9 ASN n 1 10 LEU n 1 11 TYR n 1 12 PHE n 1 13 GLN n 1 14 ALA n 1 15 GLY n 1 16 SER n 1 17 THR n 1 18 THR n 1 19 LEU n 1 20 LYS n 1 21 LEU n 1 22 LEU n 1 23 ARG n 1 24 LYS n 1 25 GLU n 1 26 ILE n 1 27 ASP n 1 28 LYS n 1 29 ILE n 1 30 ASP n 1 31 ASN n 1 32 GLN n 1 33 ILE n 1 34 ILE n 1 35 SER n 1 36 LEU n 1 37 LEU n 1 38 LYS n 1 39 LYS n 1 40 ARG n 1 41 LEU n 1 42 GLU n 1 43 ILE n 1 44 ALA n 1 45 GLN n 1 46 ALA n 1 47 ILE n 1 48 GLY n 1 49 LYS n 1 50 ILE n 1 51 LYS n 1 52 LYS n 1 53 GLU n 1 54 LEU n 1 55 ASN n 1 56 LEU n 1 57 PRO n 1 58 ILE n 1 59 GLU n 1 60 ASP n 1 61 ARG n 1 62 LYS n 1 63 ARG n 1 64 GLU n 1 65 GLU n 1 66 GLU n 1 67 VAL n 1 68 LEU n 1 69 ARG n 1 70 ARG n 1 71 ALA n 1 72 GLY n 1 73 GLU n 1 74 PHE n 1 75 ARG n 1 76 GLU n 1 77 ILE n 1 78 PHE n 1 79 GLU n 1 80 LYS n 1 81 ILE n 1 82 LEU n 1 83 GLU n 1 84 VAL n 1 85 SER n 1 86 LYS n 1 87 ASP n 1 88 VAL n 1 89 GLN n 1 90 ARG n 1 91 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UNX non-polymer . 'UNKNOWN ATOM OR ION' ? ? ? VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -14 ? ? ? A . n A 1 2 HIS 2 -13 ? ? ? A . n A 1 3 HIS 3 -12 ? ? ? A . n A 1 4 HIS 4 -11 ? ? ? A . n A 1 5 HIS 5 -10 ? ? ? A . n A 1 6 HIS 6 -9 ? ? ? A . n A 1 7 HIS 7 -8 ? ? ? A . n A 1 8 GLU 8 -7 ? ? ? A . n A 1 9 ASN 9 -6 ? ? ? A . n A 1 10 LEU 10 -5 ? ? ? A . n A 1 11 TYR 11 -4 ? ? ? A . n A 1 12 PHE 12 -3 ? ? ? A . n A 1 13 GLN 13 -2 ? ? ? A . n A 1 14 ALA 14 -1 ? ? ? A . n A 1 15 GLY 15 0 0 GLY GLY A . n A 1 16 SER 16 1 1 SER SER A . n A 1 17 THR 17 2 2 THR THR A . n A 1 18 THR 18 3 3 THR THR A . n A 1 19 LEU 19 4 4 LEU LEU A . n A 1 20 LYS 20 5 5 LYS LYS A . n A 1 21 LEU 21 6 6 LEU LEU A . n A 1 22 LEU 22 7 7 LEU LEU A . n A 1 23 ARG 23 8 8 ARG ARG A . n A 1 24 LYS 24 9 9 LYS LYS A . n A 1 25 GLU 25 10 10 GLU GLU A . n A 1 26 ILE 26 11 11 ILE ILE A . n A 1 27 ASP 27 12 12 ASP ASP A . n A 1 28 LYS 28 13 13 LYS LYS A . n A 1 29 ILE 29 14 14 ILE ILE A . n A 1 30 ASP 30 15 15 ASP ASP A . n A 1 31 ASN 31 16 16 ASN ASN A . n A 1 32 GLN 32 17 17 GLN GLN A . n A 1 33 ILE 33 18 18 ILE ILE A . n A 1 34 ILE 34 19 19 ILE ILE A . n A 1 35 SER 35 20 20 SER SER A . n A 1 36 LEU 36 21 21 LEU LEU A . n A 1 37 LEU 37 22 22 LEU LEU A . n A 1 38 LYS 38 23 23 LYS LYS A . n A 1 39 LYS 39 24 24 LYS LYS A . n A 1 40 ARG 40 25 25 ARG ARG A . n A 1 41 LEU 41 26 26 LEU LEU A . n A 1 42 GLU 42 27 27 GLU GLU A . n A 1 43 ILE 43 28 28 ILE ILE A . n A 1 44 ALA 44 29 29 ALA ALA A . n A 1 45 GLN 45 30 30 GLN GLN A . n A 1 46 ALA 46 31 31 ALA ALA A . n A 1 47 ILE 47 32 32 ILE ILE A . n A 1 48 GLY 48 33 33 GLY GLY A . n A 1 49 LYS 49 34 34 LYS LYS A . n A 1 50 ILE 50 35 35 ILE ILE A . n A 1 51 LYS 51 36 36 LYS LYS A . n A 1 52 LYS 52 37 37 LYS LYS A . n A 1 53 GLU 53 38 38 GLU GLU A . n A 1 54 LEU 54 39 39 LEU LEU A . n A 1 55 ASN 55 40 40 ASN ASN A . n A 1 56 LEU 56 41 41 LEU LEU A . n A 1 57 PRO 57 42 42 PRO PRO A . n A 1 58 ILE 58 43 43 ILE ILE A . n A 1 59 GLU 59 44 44 GLU GLU A . n A 1 60 ASP 60 45 45 ASP ASP A . n A 1 61 ARG 61 46 46 ARG ARG A . n A 1 62 LYS 62 47 47 LYS LYS A . n A 1 63 ARG 63 48 48 ARG ARG A . n A 1 64 GLU 64 49 49 GLU GLU A . n A 1 65 GLU 65 50 50 GLU GLU A . n A 1 66 GLU 66 51 51 GLU GLU A . n A 1 67 VAL 67 52 52 VAL VAL A . n A 1 68 LEU 68 53 53 LEU LEU A . n A 1 69 ARG 69 54 54 ARG ARG A . n A 1 70 ARG 70 55 55 ARG ARG A . n A 1 71 ALA 71 56 56 ALA ALA A . n A 1 72 GLY 72 57 57 GLY GLY A . n A 1 73 GLU 73 58 58 GLU GLU A . n A 1 74 PHE 74 59 59 PHE PHE A . n A 1 75 ARG 75 60 60 ARG ARG A . n A 1 76 GLU 76 61 61 GLU GLU A . n A 1 77 ILE 77 62 62 ILE ILE A . n A 1 78 PHE 78 63 63 PHE PHE A . n A 1 79 GLU 79 64 64 GLU GLU A . n A 1 80 LYS 80 65 65 LYS LYS A . n A 1 81 ILE 81 66 66 ILE ILE A . n A 1 82 LEU 82 67 67 LEU LEU A . n A 1 83 GLU 83 68 68 GLU GLU A . n A 1 84 VAL 84 69 69 VAL VAL A . n A 1 85 SER 85 70 70 SER SER A . n A 1 86 LYS 86 71 71 LYS LYS A . n A 1 87 ASP 87 72 72 ASP ASP A . n A 1 88 VAL 88 73 73 VAL VAL A . n A 1 89 GLN 89 74 74 GLN GLN A . n A 1 90 ARG 90 75 75 ARG ARG A . n A 1 91 LEU 91 76 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UNX 1 101 101 UNX UNX A . C 2 UNX 1 102 102 UNX UNX A . D 2 UNX 1 103 103 UNX UNX A . E 3 HOH 1 201 201 HOH HOH A . E 3 HOH 2 202 202 HOH HOH A . E 3 HOH 3 203 203 HOH HOH A . E 3 HOH 4 204 204 HOH HOH A . E 3 HOH 5 205 205 HOH HOH A . E 3 HOH 6 206 206 HOH HOH A . E 3 HOH 7 207 207 HOH HOH A . E 3 HOH 8 208 208 HOH HOH A . E 3 HOH 9 209 209 HOH HOH A . E 3 HOH 10 210 210 HOH HOH A . E 3 HOH 11 211 211 HOH HOH A . E 3 HOH 12 212 212 HOH HOH A . E 3 HOH 13 213 213 HOH HOH A . E 3 HOH 14 214 214 HOH HOH A . E 3 HOH 15 215 215 HOH HOH A . E 3 HOH 16 216 216 HOH HOH A . E 3 HOH 17 217 217 HOH HOH A . E 3 HOH 18 218 218 HOH HOH A . E 3 HOH 19 219 219 HOH HOH A . E 3 HOH 20 220 220 HOH HOH A . E 3 HOH 21 221 221 HOH HOH A . E 3 HOH 22 222 222 HOH HOH A . E 3 HOH 23 223 223 HOH HOH A . E 3 HOH 24 224 224 HOH HOH A . E 3 HOH 25 225 225 HOH HOH A . E 3 HOH 26 226 226 HOH HOH A . E 3 HOH 27 227 227 HOH HOH A . E 3 HOH 28 228 228 HOH HOH A . E 3 HOH 29 229 229 HOH HOH A . E 3 HOH 30 230 230 HOH HOH A . E 3 HOH 31 231 231 HOH HOH A . E 3 HOH 32 232 232 HOH HOH A . E 3 HOH 33 233 233 HOH HOH A . E 3 HOH 34 234 234 HOH HOH A . E 3 HOH 35 235 235 HOH HOH A . E 3 HOH 36 236 236 HOH HOH A . E 3 HOH 37 237 237 HOH HOH A . E 3 HOH 38 238 238 HOH HOH A . E 3 HOH 39 239 239 HOH HOH A . E 3 HOH 40 240 240 HOH HOH A . E 3 HOH 41 241 241 HOH HOH A . E 3 HOH 42 242 242 HOH HOH A . E 3 HOH 43 243 243 HOH HOH A . E 3 HOH 44 244 244 HOH HOH A . E 3 HOH 45 245 245 HOH HOH A . E 3 HOH 46 246 246 HOH HOH A . E 3 HOH 47 247 247 HOH HOH A . E 3 HOH 48 248 248 HOH HOH A . E 3 HOH 49 249 249 HOH HOH A . E 3 HOH 50 250 250 HOH HOH A . E 3 HOH 51 251 251 HOH HOH A . E 3 HOH 52 252 252 HOH HOH A . E 3 HOH 53 253 253 HOH HOH A . E 3 HOH 54 254 254 HOH HOH A . E 3 HOH 55 255 255 HOH HOH A . E 3 HOH 56 256 256 HOH HOH A . E 3 HOH 57 257 257 HOH HOH A . E 3 HOH 58 258 258 HOH HOH A . E 3 HOH 59 259 259 HOH HOH A . E 3 HOH 60 260 260 HOH HOH A . E 3 HOH 61 261 261 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 5 ? CD ? A LYS 20 CD 2 1 Y 1 A LYS 5 ? CE ? A LYS 20 CE 3 1 Y 1 A LYS 5 ? NZ ? A LYS 20 NZ 4 1 Y 1 A LYS 9 ? CE ? A LYS 24 CE 5 1 Y 1 A LYS 9 ? NZ ? A LYS 24 NZ 6 1 Y 1 A LYS 13 ? CD ? A LYS 28 CD 7 1 Y 1 A LYS 13 ? CE ? A LYS 28 CE 8 1 Y 1 A LYS 13 ? NZ ? A LYS 28 NZ 9 1 Y 1 A LYS 24 ? CE ? A LYS 39 CE 10 1 Y 1 A LYS 24 ? NZ ? A LYS 39 NZ 11 1 Y 1 A LYS 34 ? CE ? A LYS 49 CE 12 1 Y 1 A LYS 34 ? NZ ? A LYS 49 NZ 13 1 Y 1 A LYS 37 ? CG ? A LYS 52 CG 14 1 Y 1 A LYS 37 ? CD ? A LYS 52 CD 15 1 Y 1 A LYS 37 ? CE ? A LYS 52 CE 16 1 Y 1 A LYS 37 ? NZ ? A LYS 52 NZ 17 1 Y 1 A ASN 40 ? CG ? A ASN 55 CG 18 1 Y 1 A ASN 40 ? OD1 ? A ASN 55 OD1 19 1 Y 1 A ASN 40 ? ND2 ? A ASN 55 ND2 20 1 Y 1 A ILE 43 ? CD1 ? A ILE 58 CD1 21 1 Y 1 A GLU 44 ? CD ? A GLU 59 CD 22 1 Y 1 A GLU 44 ? OE1 ? A GLU 59 OE1 23 1 Y 1 A GLU 44 ? OE2 ? A GLU 59 OE2 24 1 Y 1 A ARG 46 ? CD ? A ARG 61 CD 25 1 Y 1 A ARG 46 ? NE ? A ARG 61 NE 26 1 Y 1 A ARG 46 ? CZ ? A ARG 61 CZ 27 1 Y 1 A ARG 46 ? NH1 ? A ARG 61 NH1 28 1 Y 1 A ARG 46 ? NH2 ? A ARG 61 NH2 29 1 Y 1 A LYS 47 ? NZ ? A LYS 62 NZ 30 1 Y 1 A GLU 51 ? CD ? A GLU 66 CD 31 1 Y 1 A GLU 51 ? OE1 ? A GLU 66 OE1 32 1 Y 1 A GLU 51 ? OE2 ? A GLU 66 OE2 33 1 Y 1 A LYS 71 ? CE ? A LYS 86 CE 34 1 Y 1 A LYS 71 ? NZ ? A LYS 86 NZ 35 1 Y 1 A ARG 75 ? CD ? A ARG 90 CD 36 1 Y 1 A ARG 75 ? NE ? A ARG 90 NE 37 1 Y 1 A ARG 75 ? CZ ? A ARG 90 CZ 38 1 Y 1 A ARG 75 ? NH1 ? A ARG 90 NH1 39 1 Y 1 A ARG 75 ? NH2 ? A ARG 90 NH2 # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 SOLVE 2.03 20-Sept-2002 program 'Tom Terwilliger' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 3 RESOLVE 2.03 10-Aug-2002 program 'Terwilliger, T. C' terwilliger@LANL.gov phasing http://www.solve.lanl.gov/ ? ? 4 REFMAC refmac_5.2.0005 24/04/2001 program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran ? 5 PDB_EXTRACT 1.0 02/20/2004 program H.Yang sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C/C++ ? 6 MAR345 . ? ? ? ? 'data collection' ? ? ? 7 ARP/wARP . ? ? ? ? 'model building' ? ? ? 8 # _cell.length_a 52.501 _cell.length_b 52.501 _cell.length_c 80.217 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.entry_id 1YBZ _cell.pdbx_unique_axis ? _cell.Z_PDB 8 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.Int_Tables_number 96 _symmetry.entry_id 1YBZ _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 1YBZ # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 51.63 _exptl_crystal.density_Matthews 2.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'modified microbatch' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.pdbx_details '0.8M sodium dihydrogen phosphate, 0.8M disodium hydrogen phosphate, 0.1M HEPES, pH 7.5, modified microbatch, temperature 291K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0090 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.pdbx_wavelength_list 1.0090 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22-ID # _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.82 _reflns.number_obs 10567 _reflns.percent_possible_obs 99.400 _reflns.pdbx_Rmerge_I_obs 0.055 _reflns.pdbx_chi_squared 1.550 _reflns.entry_id 1YBZ _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_low _reflns_shell.d_res_high _reflns_shell.number_measured_all _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_chi_squared _reflns_shell.number_unique_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.percent_possible_obs _reflns_shell.pdbx_redundancy _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.89 1.82 978 95.000 0.231 1.135 ? ? ? ? ? ? ? 1 1 1.96 1.89 1027 99.300 0.205 1.129 ? ? ? ? ? ? ? 2 1 2.05 1.96 1026 100.000 0.136 1.126 ? ? ? ? ? ? ? 3 1 2.16 2.05 1041 100.000 0.091 1.277 ? ? ? ? ? ? ? 4 1 2.29 2.16 1047 100.000 0.076 1.445 ? ? ? ? ? ? ? 5 1 2.47 2.29 1045 100.000 0.068 1.619 ? ? ? ? ? ? ? 6 1 2.72 2.47 1055 100.000 0.062 1.785 ? ? ? ? ? ? ? 7 1 3.11 2.72 1077 100.000 0.051 1.699 ? ? ? ? ? ? ? 8 1 3.92 3.11 1089 100.000 0.045 2.062 ? ? ? ? ? ? ? 9 1 50.00 3.92 1182 99.700 0.039 1.865 ? ? ? ? ? ? ? 10 1 # _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.B_iso_mean 17.032 _refine.aniso_B[1][1] 0.033 _refine.aniso_B[2][2] 0.033 _refine.aniso_B[3][3] -0.066 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.ls_d_res_high 1.820 _refine.ls_d_res_low 43.937 _refine.ls_number_reflns_R_free 497 _refine.ls_number_reflns_obs 10521 _refine.ls_R_factor_R_work 0.2009 _refine.ls_R_factor_R_free 0.2366 _refine.ls_R_factor_all 0.203 _refine.ls_wR_factor_R_work 0.200 _refine.ls_wR_factor_R_free 0.232 _refine.ls_percent_reflns_obs 99.320 _refine.ls_percent_reflns_R_free 4.724 _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.924 _refine.pdbx_overall_ESU_R 0.112 _refine.pdbx_overall_ESU_R_Free 0.113 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.overall_SU_R_Cruickshank_DPI 0.112 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.entry_id 1YBZ _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_obs 0.20257 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAS _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 591 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 61 _refine_hist.number_atoms_total 655 _refine_hist.d_res_high 1.820 _refine_hist.d_res_low 43.937 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 602 0.013 0.022 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 619 0.000 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 807 1.238 2.006 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 1423 3.939 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 75 4.150 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 25 27.236 24.400 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 130 11.379 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 6 21.842 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 102 0.085 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 638 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 108 0.006 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 128 0.217 0.200 ? 'X-RAY DIFFRACTION' ? r_nbd_other 468 0.210 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 298 0.165 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_other 283 0.097 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 26 0.120 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 12 0.321 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 48 0.283 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 5 0.069 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 381 2.003 2.000 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 156 0.000 2.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 621 3.049 3.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_other 530 2.027 3.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 221 2.800 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_other 463 0.000 2.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 186 4.622 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_other 893 2.240 3.000 ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_low _refine_ls_shell.d_res_high _refine_ls_shell.number_reflns_all _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free _refine_ls_shell.number_reflns_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.R_factor_all _refine_ls_shell.pdbx_refine_id 20 1.867 1.820 759 92.490 670 0.208 32 0.211 . . . . . 'X-RAY DIFFRACTION' 20 1.918 1.867 739 98.782 698 0.196 32 0.225 . . . . . 'X-RAY DIFFRACTION' 20 1.974 1.918 730 99.863 695 0.186 34 0.211 . . . . . 'X-RAY DIFFRACTION' 20 2.035 1.974 700 100.000 666 0.182 34 0.224 . . . . . 'X-RAY DIFFRACTION' 20 2.101 2.035 687 100.000 654 0.171 33 0.178 . . . . . 'X-RAY DIFFRACTION' 20 2.175 2.101 655 100.000 624 0.164 31 0.192 . . . . . 'X-RAY DIFFRACTION' 20 2.257 2.175 638 100.000 607 0.166 31 0.198 . . . . . 'X-RAY DIFFRACTION' 20 2.348 2.257 623 100.000 586 0.171 37 0.215 . . . . . 'X-RAY DIFFRACTION' 20 2.453 2.348 601 100.000 575 0.169 26 0.203 . . . . . 'X-RAY DIFFRACTION' 20 2.572 2.453 555 100.000 535 0.205 20 0.282 . . . . . 'X-RAY DIFFRACTION' 20 2.710 2.572 551 100.000 527 0.213 24 0.176 . . . . . 'X-RAY DIFFRACTION' 20 2.874 2.710 522 100.000 500 0.224 22 0.306 . . . . . 'X-RAY DIFFRACTION' 20 3.072 2.874 497 100.000 479 0.217 18 0.197 . . . . . 'X-RAY DIFFRACTION' 20 3.316 3.072 459 100.000 434 0.217 25 0.256 . . . . . 'X-RAY DIFFRACTION' 20 3.631 3.316 414 100.000 393 0.211 21 0.321 . . . . . 'X-RAY DIFFRACTION' 20 4.056 3.631 408 100.000 388 0.194 20 0.299 . . . . . 'X-RAY DIFFRACTION' 20 4.677 4.056 340 100.000 323 0.194 17 0.382 . . . . . 'X-RAY DIFFRACTION' 20 5.712 4.677 312 100.000 295 0.261 17 0.227 . . . . . 'X-RAY DIFFRACTION' 20 8.010 5.712 242 100.000 232 0.27 10 0.373 . . . . . 'X-RAY DIFFRACTION' 20 43.937 8.010 161 96.894 143 0.194 13 0.124 . . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 1YBZ _struct.title 'Conserved hypothetical protein from Pyrococcus furiosus Pfu-1581948-001' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, Isomerase ; _struct_keywords.entry_id 1YBZ _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8U098_PYRFU _struct_ref.pdbx_db_accession Q8U098 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TTLKLLRKEIDKIDNQIISLLKKRLEIAQAIGKIKKELNLPIEDRKREEEVLRRAGEFREIFEKILEVSKDVQRL _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YBZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 17 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8U098 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1YBZ ALA A 1 ? UNP Q8U098 ? ? 'cloning artifact' -14 1 1 1YBZ HIS A 2 ? UNP Q8U098 ? ? 'cloning artifact' -13 2 1 1YBZ HIS A 3 ? UNP Q8U098 ? ? 'cloning artifact' -12 3 1 1YBZ HIS A 4 ? UNP Q8U098 ? ? 'cloning artifact' -11 4 1 1YBZ HIS A 5 ? UNP Q8U098 ? ? 'cloning artifact' -10 5 1 1YBZ HIS A 6 ? UNP Q8U098 ? ? 'cloning artifact' -9 6 1 1YBZ HIS A 7 ? UNP Q8U098 ? ? 'cloning artifact' -8 7 1 1YBZ GLU A 8 ? UNP Q8U098 ? ? 'cloning artifact' -7 8 1 1YBZ ASN A 9 ? UNP Q8U098 ? ? 'cloning artifact' -6 9 1 1YBZ LEU A 10 ? UNP Q8U098 ? ? 'cloning artifact' -5 10 1 1YBZ TYR A 11 ? UNP Q8U098 ? ? 'cloning artifact' -4 11 1 1YBZ PHE A 12 ? UNP Q8U098 ? ? 'cloning artifact' -3 12 1 1YBZ GLN A 13 ? UNP Q8U098 ? ? 'cloning artifact' -2 13 1 1YBZ ALA A 14 ? UNP Q8U098 ? ? 'cloning artifact' -1 14 1 1YBZ GLY A 15 ? UNP Q8U098 ? ? 'cloning artifact' 0 15 1 1YBZ SER A 16 ? UNP Q8U098 ? ? 'cloning artifact' 1 16 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 3880 ? 2 MORE -35 ? 2 'SSA (A^2)' 8660 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E 2 1,2 A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? LEU A 54 ? SER A 1 LEU A 39 1 ? 39 HELX_P HELX_P2 2 ASP A 60 ? GLY A 72 ? ASP A 45 GLY A 57 1 ? 13 HELX_P HELX_P3 3 PHE A 74 ? ARG A 90 ? PHE A 59 ARG A 75 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A UNX 101 ? 3 'BINDING SITE FOR RESIDUE UNX A 101' AC2 Software A UNX 102 ? 2 'BINDING SITE FOR RESIDUE UNX A 102' AC3 Software A UNX 103 ? 3 'BINDING SITE FOR RESIDUE UNX A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 40 ? ARG A 25 . ? 1_555 ? 2 AC1 3 LEU A 82 ? LEU A 67 . ? 1_555 ? 3 AC1 3 SER A 85 ? SER A 70 . ? 1_555 ? 4 AC2 2 ASP A 60 ? ASP A 45 . ? 1_555 ? 5 AC2 2 ARG A 63 ? ARG A 48 . ? 1_555 ? 6 AC3 3 LYS A 39 ? LYS A 24 . ? 1_555 ? 7 AC3 3 GLU A 65 ? GLU A 50 . ? 5_544 ? 8 AC3 3 ARG A 75 ? ARG A 60 . ? 5_544 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.58 120.30 4.28 0.50 N 2 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH2 A ARG 8 ? ? 117.02 120.30 -3.28 0.50 N # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Southeast Collaboratory for Structural Genomics' _pdbx_SG_project.initial_of_center SECSG _pdbx_SG_project.id 1 # loop_ _pdbx_phasing_MAD_shell.d_res_low _pdbx_phasing_MAD_shell.d_res_high _pdbx_phasing_MAD_shell.reflns _pdbx_phasing_MAD_shell.fom 20.000 8.81 226 0.22 8.81 5.75 335 0.30 5.75 4.55 405 0.27 4.55 3.88 472 0.24 3.88 3.44 524 0.22 3.44 3.12 559 0.28 3.12 2.88 603 0.23 2.88 2.68 620 0.19 # _pdbx_phasing_dm.entry_id 1YBZ _pdbx_phasing_dm.fom_acentric 0.57 _pdbx_phasing_dm.fom_centric 0.51 _pdbx_phasing_dm.fom 0.56 _pdbx_phasing_dm.reflns_acentric 3619 _pdbx_phasing_dm.reflns_centric 1038 _pdbx_phasing_dm.reflns 4657 # loop_ _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 18.791 6.9 0.87 0.68 0.87 114 116 230 6.9 4.3 0.81 0.58 0.73 460 221 681 4.3 3.4 0.80 0.65 0.76 611 189 800 3.4 3.0 0.66 0.51 0.63 624 167 791 3.0 2.6 0.46 0.37 0.45 1127 231 1358 2.6 2.4 0.25 0.28 0.26 683 114 797 # _phasing.method SAD # _phasing_MAD.entry_id 1YBZ _phasing_MAD.pdbx_d_res_high 2.600 _phasing_MAD.pdbx_d_res_low 20.000 _phasing_MAD.pdbx_reflns 3744 _phasing_MAD.pdbx_fom 0.24 # _pdbx_database_remark.id 300 _pdbx_database_remark.text ;BIOMOLECULE: THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 1 CHAIN. THE BIOLOGICAL UNIT IS UNKNOWN. ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA -14 ? A ALA 1 2 1 Y 1 A HIS -13 ? A HIS 2 3 1 Y 1 A HIS -12 ? A HIS 3 4 1 Y 1 A HIS -11 ? A HIS 4 5 1 Y 1 A HIS -10 ? A HIS 5 6 1 Y 1 A HIS -9 ? A HIS 6 7 1 Y 1 A HIS -8 ? A HIS 7 8 1 Y 1 A GLU -7 ? A GLU 8 9 1 Y 1 A ASN -6 ? A ASN 9 10 1 Y 1 A LEU -5 ? A LEU 10 11 1 Y 1 A TYR -4 ? A TYR 11 12 1 Y 1 A PHE -3 ? A PHE 12 13 1 Y 1 A GLN -2 ? A GLN 13 14 1 Y 1 A ALA -1 ? A ALA 14 15 1 Y 1 A LEU 76 ? A LEU 91 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TYR N N N N 287 TYR CA C N S 288 TYR C C N N 289 TYR O O N N 290 TYR CB C N N 291 TYR CG C Y N 292 TYR CD1 C Y N 293 TYR CD2 C Y N 294 TYR CE1 C Y N 295 TYR CE2 C Y N 296 TYR CZ C Y N 297 TYR OH O N N 298 TYR OXT O N N 299 TYR H H N N 300 TYR H2 H N N 301 TYR HA H N N 302 TYR HB2 H N N 303 TYR HB3 H N N 304 TYR HD1 H N N 305 TYR HD2 H N N 306 TYR HE1 H N N 307 TYR HE2 H N N 308 TYR HH H N N 309 TYR HXT H N N 310 VAL N N N N 311 VAL CA C N S 312 VAL C C N N 313 VAL O O N N 314 VAL CB C N N 315 VAL CG1 C N N 316 VAL CG2 C N N 317 VAL OXT O N N 318 VAL H H N N 319 VAL H2 H N N 320 VAL HA H N N 321 VAL HB H N N 322 VAL HG11 H N N 323 VAL HG12 H N N 324 VAL HG13 H N N 325 VAL HG21 H N N 326 VAL HG22 H N N 327 VAL HG23 H N N 328 VAL HXT H N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 PRO N CA sing N N 228 PRO N CD sing N N 229 PRO N H sing N N 230 PRO CA C sing N N 231 PRO CA CB sing N N 232 PRO CA HA sing N N 233 PRO C O doub N N 234 PRO C OXT sing N N 235 PRO CB CG sing N N 236 PRO CB HB2 sing N N 237 PRO CB HB3 sing N N 238 PRO CG CD sing N N 239 PRO CG HG2 sing N N 240 PRO CG HG3 sing N N 241 PRO CD HD2 sing N N 242 PRO CD HD3 sing N N 243 PRO OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TYR N CA sing N N 274 TYR N H sing N N 275 TYR N H2 sing N N 276 TYR CA C sing N N 277 TYR CA CB sing N N 278 TYR CA HA sing N N 279 TYR C O doub N N 280 TYR C OXT sing N N 281 TYR CB CG sing N N 282 TYR CB HB2 sing N N 283 TYR CB HB3 sing N N 284 TYR CG CD1 doub Y N 285 TYR CG CD2 sing Y N 286 TYR CD1 CE1 sing Y N 287 TYR CD1 HD1 sing N N 288 TYR CD2 CE2 doub Y N 289 TYR CD2 HD2 sing N N 290 TYR CE1 CZ doub Y N 291 TYR CE1 HE1 sing N N 292 TYR CE2 CZ sing Y N 293 TYR CE2 HE2 sing N N 294 TYR CZ OH sing N N 295 TYR OH HH sing N N 296 TYR OXT HXT sing N N 297 VAL N CA sing N N 298 VAL N H sing N N 299 VAL N H2 sing N N 300 VAL CA C sing N N 301 VAL CA CB sing N N 302 VAL CA HA sing N N 303 VAL C O doub N N 304 VAL C OXT sing N N 305 VAL CB CG1 sing N N 306 VAL CB CG2 sing N N 307 VAL CB HB sing N N 308 VAL CG1 HG11 sing N N 309 VAL CG1 HG12 sing N N 310 VAL CG1 HG13 sing N N 311 VAL CG2 HG21 sing N N 312 VAL CG2 HG22 sing N N 313 VAL CG2 HG23 sing N N 314 VAL OXT HXT sing N N 315 # _atom_sites.entry_id 1YBZ _atom_sites.fract_transf_matrix[1][1] 0.0190 _atom_sites.fract_transf_matrix[1][2] 0.0000 _atom_sites.fract_transf_matrix[1][3] 0.0000 _atom_sites.fract_transf_matrix[2][1] 0.0000 _atom_sites.fract_transf_matrix[2][2] 0.0190 _atom_sites.fract_transf_matrix[2][3] 0.0000 _atom_sites.fract_transf_matrix[3][1] 0.0000 _atom_sites.fract_transf_matrix[3][2] 0.0000 _atom_sites.fract_transf_matrix[3][3] 0.0125 _atom_sites.fract_transf_vector[1] 0.0000 _atom_sites.fract_transf_vector[2] 0.0000 _atom_sites.fract_transf_vector[3] 0.0000 # loop_ _atom_type.symbol C N O X # loop_