data_1YEZ # _entry.id 1YEZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1YEZ RCSB RCSB031439 WWPDB D_1000031439 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id MaR30 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YEZ _pdbx_database_status.recvd_initial_deposition_date 2004-12-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rossi, P.' 1 'Aramini, J.M.' 2 'Swapna, G.V.T.' 3 'Huang, Y.P.' 4 'Xiao, R.' 5 'Ho, C.K.' 6 'Ma, L.C.' 7 'Acton, T.B.' 8 'Montelione, G.T.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title ;Solution structure of the conserved protein from the gene locus MM1357 of Methanosarcina mazei. Northeast Structural Genomics target MaR30. ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Rossi, P.' 1 primary 'Aramini, J.M.' 2 primary 'Swapna, G.V.T.' 3 primary 'Huang, Y.P.' 4 primary 'Xiao, R.' 5 primary 'Ho, C.K.' 6 primary 'Ma, L.C.' 7 primary 'Acton, T.B.' 8 primary 'Montelione, G.T.' 9 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description MM1357 _entity.formula_weight 7620.669 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MFREESRSVPVEEGEVYDVTIQDIARQGDGIARIEGFVIFVPGTKVGDEVRIKVERVLPKFAFASVVE _entity_poly.pdbx_seq_one_letter_code_can MFREESRSVPVEEGEVYDVTIQDIARQGDGIARIEGFVIFVPGTKVGDEVRIKVERVLPKFAFASVVE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MaR30 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 ARG n 1 4 GLU n 1 5 GLU n 1 6 SER n 1 7 ARG n 1 8 SER n 1 9 VAL n 1 10 PRO n 1 11 VAL n 1 12 GLU n 1 13 GLU n 1 14 GLY n 1 15 GLU n 1 16 VAL n 1 17 TYR n 1 18 ASP n 1 19 VAL n 1 20 THR n 1 21 ILE n 1 22 GLN n 1 23 ASP n 1 24 ILE n 1 25 ALA n 1 26 ARG n 1 27 GLN n 1 28 GLY n 1 29 ASP n 1 30 GLY n 1 31 ILE n 1 32 ALA n 1 33 ARG n 1 34 ILE n 1 35 GLU n 1 36 GLY n 1 37 PHE n 1 38 VAL n 1 39 ILE n 1 40 PHE n 1 41 VAL n 1 42 PRO n 1 43 GLY n 1 44 THR n 1 45 LYS n 1 46 VAL n 1 47 GLY n 1 48 ASP n 1 49 GLU n 1 50 VAL n 1 51 ARG n 1 52 ILE n 1 53 LYS n 1 54 VAL n 1 55 GLU n 1 56 ARG n 1 57 VAL n 1 58 LEU n 1 59 PRO n 1 60 LYS n 1 61 PHE n 1 62 ALA n 1 63 PHE n 1 64 ALA n 1 65 SER n 1 66 VAL n 1 67 VAL n 1 68 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Methanosarcina _entity_src_gen.pdbx_gene_src_gene 'Locus MM1357' _entity_src_gen.gene_src_species 'Methanosarcina mazei' _entity_src_gen.gene_src_strain Go1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanosarcina mazei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 192952 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21MGK _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector PET21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name MaR30-21.1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8PX65_METMA _struct_ref.pdbx_db_accession Q8PX65 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MFREESRSVPVEEGEVYDVTIQDIARQGDGIARIEGFVIFVPGTKVGDEVRIKVERVLPKFAFASVVE _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YEZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8PX65 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 3D_13C-separated_NOESY 2 4 1 'Hi-res CH-HSQC, HcCH-COSY' 2 5 1 'Hi-res CH-HSQC (stereo V and L Meth.), HNHA' 3 6 1 'TR exp. backbone, TOCSYs, HcCH-COSY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure atmospheric _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;2mM MaR30 U-13C,15N, 0.02% NaN3, 10mM DTT, 5mM CaCl2, 100mM NaCl, 20mM MES, 5% D2O/95% H2O ; '5% D2O/95% H2O' 2 ;0.56mM MaR30 U-13C,15N, 0.02% NaN3, 10mM DTT, 5mM CaCl2, 100mM NaCl, 20mM MES, 100% D2O ; '100% D2O' 3 ;0.78mM MaR30 U-15N,5% 13C 0.02% NaN3, 10mM DTT, 5mM CaCl2, 100mM NaCl, 20mM MES, 5% D2O/95% H2O ; '5% D2O/95% H2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 600 ? 2 Avance Bruker 500 ? # _pdbx_nmr_details.entry_id 1YEZ _pdbx_nmr_details.text ;CS assign.: Backbone AutoAssign, sidechain HcCH-COSY and TOCSYs. AutoStructure for noesy assign. Hyper Dihedral, Dyana, Xplor(nih), and CNS force-field for simulated annealing and RPF score calculation. ; # _pdbx_nmr_ensemble.entry_id 1YEZ _pdbx_nmr_ensemble.conformers_calculated_total_number 56 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1YEZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 collection XWINNMR 3.5 'Bruker Biospin' 2 processing NMRPipe 2.1 Delaglio 3 'data analysis' Sparky 3.91 Goddard 4 'data analysis' AutoAssign 1.14 Zimmerman,Moseley,Montelione 5 refinement AutoStructure 2.1.0 Huang,Montelione 6 # _exptl.entry_id 1YEZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1YEZ _struct.title ;Solution structure of the conserved protein from the gene locus MM1357 of Methanosarcina mazei. Northeast Structural Genomics target MaR30. ; _struct.pdbx_descriptor MM1357 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YEZ _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;MaR30, Autostructure, Northeast Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 15 ? THR A 20 ? GLU A 15 THR A 20 A 2 GLU A 49 ? VAL A 57 ? GLU A 49 VAL A 57 A 3 ALA A 62 ? VAL A 66 ? ALA A 62 VAL A 66 A 4 PHE A 37 ? PRO A 42 ? PHE A 37 PRO A 42 A 5 ASP A 29 ? ILE A 34 ? ASP A 29 ILE A 34 A 6 ASP A 23 ? ILE A 24 ? ASP A 23 ILE A 24 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 17 ? N TYR A 17 O ILE A 52 ? O ILE A 52 A 2 3 N LYS A 53 ? N LYS A 53 O SER A 65 ? O SER A 65 A 3 4 O ALA A 62 ? O ALA A 62 N PHE A 40 ? N PHE A 40 A 4 5 O ILE A 39 ? O ILE A 39 N ALA A 32 ? N ALA A 32 A 5 6 O ILE A 31 ? O ILE A 31 N ASP A 23 ? N ASP A 23 # _database_PDB_matrix.entry_id 1YEZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1YEZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLU 68 68 68 GLU GLU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-02-22 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 8 O A GLU 5 ? ? HG A SER 6 ? ? 1.53 2 9 O A ARG 7 ? ? HG A SER 8 ? ? 1.55 3 10 H A GLY 14 ? ? O A VAL 54 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 8 ? ? -68.12 94.68 2 1 ARG A 26 ? ? -64.62 92.94 3 1 GLN A 27 ? ? 166.27 -27.11 4 1 GLU A 35 ? ? 57.56 12.89 5 1 VAL A 54 ? ? -69.29 97.24 6 2 SER A 6 ? ? 57.81 13.07 7 2 ARG A 7 ? ? 66.36 -57.68 8 2 ARG A 26 ? ? 57.88 85.63 9 2 GLN A 27 ? ? 171.56 -24.85 10 2 VAL A 54 ? ? -69.25 99.13 11 3 PHE A 2 ? ? 176.37 -77.84 12 3 ARG A 3 ? ? -175.12 22.92 13 3 GLU A 5 ? ? 67.61 -170.47 14 3 SER A 8 ? ? -82.39 33.86 15 3 VAL A 54 ? ? -68.94 98.40 16 4 ARG A 3 ? ? 66.66 -165.87 17 4 SER A 6 ? ? 59.77 14.37 18 4 ARG A 7 ? ? 62.60 -76.97 19 4 SER A 8 ? ? 66.51 -161.31 20 4 VAL A 9 ? ? 35.33 70.65 21 4 GLN A 27 ? ? -158.60 -36.06 22 5 SER A 6 ? ? -137.88 -51.49 23 5 ARG A 7 ? ? 64.55 120.25 24 5 VAL A 9 ? ? 60.39 170.26 25 5 PRO A 59 ? ? -58.89 -1.46 26 6 GLU A 4 ? ? 61.60 71.00 27 6 GLU A 5 ? ? 42.46 -156.71 28 6 SER A 6 ? ? -133.79 -55.51 29 6 ARG A 7 ? ? -175.80 67.80 30 7 ARG A 3 ? ? 73.67 152.45 31 7 ARG A 7 ? ? 67.38 -36.97 32 7 SER A 8 ? ? 62.20 70.79 33 7 ALA A 25 ? ? -98.55 -150.79 34 7 GLN A 27 ? ? 72.65 -74.84 35 8 ARG A 3 ? ? -150.07 -53.87 36 8 GLU A 4 ? ? 177.96 -19.63 37 8 GLU A 5 ? ? 74.30 -158.72 38 8 ARG A 7 ? ? -88.92 -159.37 39 8 PRO A 59 ? ? -68.13 11.00 40 9 PHE A 2 ? ? 64.86 95.98 41 9 ARG A 3 ? ? 71.89 -9.69 42 9 GLU A 5 ? ? 56.44 -154.45 43 9 SER A 8 ? ? 66.62 -20.85 44 10 PHE A 2 ? ? 62.74 -169.28 45 10 ARG A 3 ? ? -156.54 -35.99 46 10 GLU A 4 ? ? 75.18 96.52 47 10 GLU A 5 ? ? -75.70 -163.47 48 10 SER A 6 ? ? 73.62 76.64 49 10 SER A 8 ? ? -67.93 96.55 50 10 VAL A 9 ? ? 69.97 115.95 51 10 ARG A 26 ? ? -172.64 127.46 52 10 GLN A 27 ? ? 79.55 -63.29 53 10 GLU A 35 ? ? 67.78 -3.10 #