data_1YJV # _entry.id 1YJV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YJV pdb_00001yjv 10.2210/pdb1yjv/pdb RCSB RCSB031596 ? ? WWPDB D_1000031596 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-03 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YJV _pdbx_database_status.recvd_initial_deposition_date 2005-01-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1YJU 'Apo form of the sixth soluble domain of Copper-transporting ATPase 1' unspecified PDB 1YJT 'Cu(I) form of the sixth soluble domain A69P mutant of Copper-transporting ATPase 1' unspecified PDB 1YJR 'Apo form of the sixth soluble domain A69P mutant of Copper-transporting ATPase 1' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Banci, L.' 1 'Bertini, I.' 2 'Cantini, F.' 3 'Migliardi, M.' 4 'Rosato, A.' 5 'Wang, S.' 6 # _citation.id primary _citation.title 'An atomic-level investigation of the disease-causing A629P mutant of the Menkes protein, ATP7A' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 352 _citation.page_first 409 _citation.page_last 417 _citation.year 2005 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16083905 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2005.07.034 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Banci, L.' 1 ? primary 'Bertini, I.' 2 ? primary 'Cantini, F.' 3 ? primary 'Migliardi, M.' 4 ? primary 'Rosato, A.' 5 ? primary 'Wang, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Copper-transporting ATPase 1' 8191.593 1 3.6.3.4 ? 'Sixth soluble domain' ? 2 non-polymer syn 'COPPER (I) ION' 63.546 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Copper pump 1, Menkes disease-associated protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKIE _entity_poly.pdbx_seq_one_letter_code_can MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKIE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'COPPER (I) ION' _pdbx_entity_nonpoly.comp_id CU1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASP n 1 4 GLY n 1 5 VAL n 1 6 LEU n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 VAL n 1 11 ARG n 1 12 GLY n 1 13 MET n 1 14 THR n 1 15 CYS n 1 16 ALA n 1 17 SER n 1 18 CYS n 1 19 VAL n 1 20 HIS n 1 21 LYS n 1 22 ILE n 1 23 GLU n 1 24 SER n 1 25 SER n 1 26 LEU n 1 27 THR n 1 28 LYS n 1 29 HIS n 1 30 ARG n 1 31 GLY n 1 32 ILE n 1 33 LEU n 1 34 TYR n 1 35 CYS n 1 36 SER n 1 37 VAL n 1 38 ALA n 1 39 LEU n 1 40 ALA n 1 41 THR n 1 42 ASN n 1 43 LYS n 1 44 ALA n 1 45 HIS n 1 46 ILE n 1 47 LYS n 1 48 TYR n 1 49 ASP n 1 50 PRO n 1 51 GLU n 1 52 ILE n 1 53 ILE n 1 54 GLY n 1 55 PRO n 1 56 ARG n 1 57 ASP n 1 58 ILE n 1 59 ILE n 1 60 HIS n 1 61 THR n 1 62 ILE n 1 63 GLU n 1 64 SER n 1 65 LEU n 1 66 GLY n 1 67 PHE n 1 68 GLU n 1 69 ALA n 1 70 SER n 1 71 LEU n 1 72 VAL n 1 73 LYS n 1 74 ILE n 1 75 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ATP7A _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET20b+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU1 non-polymer . 'COPPER (I) ION' ? 'Cu 1' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLU 75 75 75 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CU1 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 76 _pdbx_nonpoly_scheme.auth_seq_num 76 _pdbx_nonpoly_scheme.pdb_mon_id CU1 _pdbx_nonpoly_scheme.auth_mon_id CU _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 1YJV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1YJV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1YJV _struct.title 'Solution structure of the Cu(I) form of the sixth soluble domain of Menkes protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YJV _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'metallochaperone, protein-protein interaction, copper(I), metal homeostasis, hydrolase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATP7A_HUMAN _struct_ref.pdbx_db_accession Q04656 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVK _struct_ref.pdbx_align_begin 562 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YJV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q04656 _struct_ref_seq.db_align_beg 562 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 633 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1YJV MET A 1 ? UNP Q04656 ? ? 'cloning artifact' 1 1 1 1YJV ILE A 74 ? UNP Q04656 ? ? 'cloning artifact' 74 2 1 1YJV GLU A 75 ? UNP Q04656 ? ? 'cloning artifact' 75 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 15 ? THR A 27 ? CYS A 15 THR A 27 1 ? 13 HELX_P HELX_P2 2 GLY A 54 ? GLY A 66 ? GLY A 54 GLY A 66 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 15 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 15 A CU1 76 1_555 ? ? ? ? ? ? ? 2.164 ? ? metalc2 metalc ? ? A CYS 18 SG ? ? ? 1_555 B CU1 . CU ? ? A CYS 18 A CU1 76 1_555 ? ? ? ? ? ? ? 2.169 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id SG _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id CYS _pdbx_struct_conn_angle.ptnr1_label_seq_id 15 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id CYS _pdbx_struct_conn_angle.ptnr1_auth_seq_id 15 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id CU _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id CU1 _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id CU1 _pdbx_struct_conn_angle.ptnr2_auth_seq_id 76 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id SG _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id CYS _pdbx_struct_conn_angle.ptnr3_label_seq_id 18 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id CYS _pdbx_struct_conn_angle.ptnr3_auth_seq_id 18 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 157.2 _pdbx_struct_conn_angle.value_esd ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 32 ? ALA A 38 ? ILE A 32 ALA A 38 A 2 LYS A 43 ? TYR A 48 ? LYS A 43 TYR A 48 A 3 GLY A 4 ? ARG A 11 ? GLY A 4 ARG A 11 A 4 GLU A 68 ? SER A 70 ? GLU A 68 SER A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 34 ? N TYR A 34 O LYS A 47 ? O LYS A 47 A 2 3 O ILE A 46 ? O ILE A 46 N LEU A 6 ? N LEU A 6 A 3 4 N VAL A 9 ? N VAL A 9 O SER A 70 ? O SER A 70 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CU1 _struct_site.pdbx_auth_seq_id 76 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE CU1 A 76' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 THR A 14 ? THR A 14 . ? 1_555 ? 2 AC1 3 CYS A 15 ? CYS A 15 . ? 1_555 ? 3 AC1 3 CYS A 18 ? CYS A 18 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 8 NE A ARG 11 ? ? CZ A ARG 11 ? ? NH2 A ARG 11 ? ? 117.03 120.30 -3.27 0.50 N 2 15 NE A ARG 11 ? ? CZ A ARG 11 ? ? NH2 A ARG 11 ? ? 116.83 120.30 -3.47 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 42 ? ? 71.13 57.81 2 1 LEU A 65 ? ? -72.26 -102.43 3 1 ILE A 74 ? ? -61.43 -79.35 4 2 ASP A 3 ? ? -148.81 26.52 5 2 ASN A 42 ? ? 83.92 52.90 6 2 LEU A 65 ? ? -61.75 -82.11 7 2 LYS A 73 ? ? -167.60 -53.77 8 2 ILE A 74 ? ? -77.33 -71.90 9 3 SER A 36 ? ? -152.11 83.35 10 3 ASN A 42 ? ? 80.89 61.79 11 3 GLU A 51 ? ? -77.20 44.67 12 3 ILE A 52 ? ? -172.49 -38.34 13 3 LYS A 73 ? ? -147.26 -64.58 14 4 GLU A 51 ? ? -145.61 -53.74 15 4 LEU A 65 ? ? -65.70 -89.42 16 4 LYS A 73 ? ? -170.73 -50.32 17 5 MET A 13 ? ? -67.34 65.27 18 5 ASN A 42 ? ? 35.32 52.08 19 5 GLU A 51 ? ? -167.26 -46.72 20 5 LEU A 65 ? ? -68.97 -83.27 21 6 ASP A 3 ? ? 148.07 177.67 22 6 MET A 13 ? ? -60.04 77.36 23 6 LYS A 28 ? ? -167.61 -23.40 24 6 ARG A 30 ? ? 70.83 -54.35 25 6 ASN A 42 ? ? 64.26 76.04 26 6 LEU A 65 ? ? -59.63 -73.70 27 6 VAL A 72 ? ? 64.38 -73.52 28 7 ASP A 3 ? ? -17.00 -66.38 29 7 LYS A 28 ? ? -143.05 -48.10 30 7 HIS A 29 ? ? -69.99 26.20 31 7 ARG A 30 ? ? 66.02 -60.75 32 7 ASN A 42 ? ? 23.23 70.83 33 7 GLU A 51 ? ? -158.38 -52.66 34 7 LEU A 65 ? ? -72.80 -101.55 35 7 ILE A 74 ? ? -147.76 -54.20 36 8 MET A 13 ? ? -69.44 68.20 37 8 PRO A 50 ? ? -80.97 46.28 38 8 GLU A 51 ? ? -137.45 -62.03 39 8 LEU A 65 ? ? -60.02 -86.22 40 8 LYS A 73 ? ? -170.55 -179.26 41 9 ARG A 30 ? ? -47.59 -16.14 42 9 LYS A 73 ? ? 32.50 72.83 43 10 MET A 13 ? ? -69.94 74.46 44 10 THR A 27 ? ? -69.77 67.49 45 10 LYS A 28 ? ? -158.39 -42.59 46 10 GLU A 51 ? ? -161.66 -55.65 47 10 LEU A 65 ? ? -64.77 -92.60 48 11 GLU A 51 ? ? -171.50 -45.02 49 11 LEU A 65 ? ? -71.87 -74.86 50 12 LYS A 28 ? ? -176.48 -48.20 51 12 ARG A 30 ? ? -51.76 105.10 52 12 SER A 36 ? ? -155.25 82.78 53 12 GLU A 51 ? ? -80.80 42.04 54 12 ILE A 52 ? ? -175.50 -43.67 55 12 VAL A 72 ? ? -137.07 -62.17 56 12 LYS A 73 ? ? 67.34 -66.52 57 13 ASP A 3 ? ? -44.50 151.03 58 13 MET A 13 ? ? -69.14 78.98 59 13 ASN A 42 ? ? 32.29 53.08 60 13 LEU A 65 ? ? -68.38 -97.73 61 14 ASP A 3 ? ? 50.75 -139.60 62 14 LEU A 65 ? ? -65.83 -81.32 63 15 MET A 13 ? ? -63.31 75.74 64 15 LEU A 65 ? ? -62.56 -70.91 65 15 VAL A 72 ? ? -110.34 -94.41 66 15 LYS A 73 ? ? 70.22 -53.87 67 16 SER A 36 ? ? -154.48 85.04 68 16 THR A 41 ? ? -140.79 20.03 69 16 ASN A 42 ? ? 36.77 47.27 70 16 LEU A 65 ? ? -68.16 -91.37 71 17 THR A 14 ? ? 58.71 -63.25 72 17 ASN A 42 ? ? 73.91 56.59 73 17 ARG A 56 ? ? -29.29 -58.23 74 17 LEU A 65 ? ? -66.04 -85.90 75 17 LYS A 73 ? ? 171.06 122.71 76 18 ASP A 3 ? ? 3.98 95.99 77 18 GLU A 7 ? ? -109.53 70.81 78 18 ARG A 30 ? ? -75.20 36.11 79 18 ASN A 42 ? ? 33.95 48.89 80 18 LEU A 65 ? ? -58.92 -85.44 81 18 VAL A 72 ? ? 59.22 -43.82 82 18 LYS A 73 ? ? -65.35 88.92 83 19 MET A 13 ? ? -68.51 77.60 84 19 ILE A 52 ? ? -132.39 -63.56 85 19 LEU A 65 ? ? -64.13 -84.05 86 19 VAL A 72 ? ? -95.40 -74.35 87 19 LYS A 73 ? ? 62.59 -65.14 88 20 ARG A 30 ? ? 72.17 -44.54 89 20 ALA A 44 ? ? -150.99 87.41 90 20 PRO A 50 ? ? -79.79 36.20 91 20 GLU A 51 ? ? -140.22 33.23 92 20 ILE A 52 ? ? -171.83 -49.71 93 21 ASP A 3 ? ? 167.48 157.05 94 21 ASN A 42 ? ? 68.89 71.75 95 21 LEU A 65 ? ? -72.13 -91.01 96 21 LYS A 73 ? ? 40.08 79.72 97 22 LYS A 28 ? ? -57.53 -9.67 98 22 ARG A 30 ? ? 70.62 -51.05 99 22 ASN A 42 ? ? 25.60 61.40 100 22 ILE A 74 ? ? -145.98 -62.42 101 23 ARG A 30 ? ? -52.69 100.43 102 23 LEU A 65 ? ? -73.55 -95.41 103 23 LYS A 73 ? ? -175.73 -44.64 104 24 ILE A 22 ? ? -69.59 -74.30 105 24 ARG A 30 ? ? -65.63 5.27 106 24 GLU A 51 ? ? -169.35 -45.27 107 24 VAL A 72 ? ? -149.86 26.30 108 25 MET A 13 ? ? 36.14 60.84 109 25 ASN A 42 ? ? 65.88 74.31 110 25 PRO A 50 ? ? -78.56 44.10 111 25 ILE A 52 ? ? -157.19 -30.78 112 25 LEU A 65 ? ? -70.76 -80.16 113 25 VAL A 72 ? ? -130.83 -86.58 114 25 LYS A 73 ? ? 61.63 171.05 115 26 MET A 13 ? ? 2.31 66.42 116 26 HIS A 29 ? ? -74.02 -122.26 117 26 ARG A 30 ? ? -157.18 -62.45 118 26 GLU A 51 ? ? -173.39 -49.01 119 26 LEU A 65 ? ? -71.23 -96.27 120 26 LYS A 73 ? ? -146.21 -35.95 121 26 ILE A 74 ? ? -128.23 -63.71 122 27 VAL A 5 ? ? -119.69 78.40 123 27 ASN A 42 ? ? 33.41 43.72 124 27 LEU A 65 ? ? -63.55 -82.89 125 27 ILE A 74 ? ? -131.44 -64.48 126 28 LEU A 65 ? ? -78.31 -96.60 127 28 LYS A 73 ? ? 70.04 152.92 128 29 ARG A 30 ? ? -42.97 102.23 129 29 ASN A 42 ? ? 67.20 79.71 130 29 GLU A 51 ? ? -144.82 -59.70 131 30 ASP A 3 ? ? 36.64 -108.50 132 30 MET A 13 ? ? -65.96 71.95 133 30 THR A 27 ? ? -56.40 -9.12 134 30 LEU A 65 ? ? -81.38 -96.56 135 30 VAL A 72 ? ? -127.51 -64.11 136 30 LYS A 73 ? ? 55.55 98.49 137 30 ILE A 74 ? ? -68.00 74.84 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 3 GLY A 66 ? ? PHE A 67 ? ? -136.27 2 3 LYS A 73 ? ? ILE A 74 ? ? 144.97 3 6 MET A 1 ? ? GLY A 2 ? ? -135.37 4 6 GLY A 2 ? ? ASP A 3 ? ? -145.50 5 6 TYR A 48 ? ? ASP A 49 ? ? 142.15 6 6 GLY A 66 ? ? PHE A 67 ? ? -137.02 7 7 ILE A 74 ? ? GLU A 75 ? ? 142.81 8 9 GLY A 66 ? ? PHE A 67 ? ? -139.96 9 10 ILE A 74 ? ? GLU A 75 ? ? 149.79 10 11 GLY A 66 ? ? PHE A 67 ? ? -146.99 11 12 GLY A 66 ? ? PHE A 67 ? ? -139.83 12 13 GLY A 2 ? ? ASP A 3 ? ? 138.16 13 15 MET A 1 ? ? GLY A 2 ? ? 135.62 14 15 GLY A 66 ? ? PHE A 67 ? ? -137.08 15 17 LEU A 8 ? ? VAL A 9 ? ? 148.20 16 17 GLY A 66 ? ? PHE A 67 ? ? -148.02 17 20 GLY A 2 ? ? ASP A 3 ? ? -145.78 18 20 GLY A 66 ? ? PHE A 67 ? ? -142.82 19 22 GLY A 66 ? ? PHE A 67 ? ? -127.75 20 22 ILE A 74 ? ? GLU A 75 ? ? 143.75 21 23 MET A 1 ? ? GLY A 2 ? ? 134.59 22 23 LEU A 8 ? ? VAL A 9 ? ? 147.32 23 24 LEU A 8 ? ? VAL A 9 ? ? 149.84 24 24 GLY A 66 ? ? PHE A 67 ? ? -143.47 25 26 ILE A 74 ? ? GLU A 75 ? ? 139.57 26 27 ILE A 74 ? ? GLU A 75 ? ? 136.76 27 28 MET A 1 ? ? GLY A 2 ? ? 136.14 28 29 GLY A 31 ? ? ILE A 32 ? ? 148.58 29 29 GLY A 66 ? ? PHE A 67 ? ? -137.78 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 30 ? ? 0.153 'SIDE CHAIN' 2 1 TYR A 34 ? ? 0.079 'SIDE CHAIN' 3 1 ARG A 56 ? ? 0.184 'SIDE CHAIN' 4 2 ARG A 30 ? ? 0.102 'SIDE CHAIN' 5 2 TYR A 34 ? ? 0.171 'SIDE CHAIN' 6 2 ARG A 56 ? ? 0.078 'SIDE CHAIN' 7 3 TYR A 34 ? ? 0.134 'SIDE CHAIN' 8 3 TYR A 48 ? ? 0.066 'SIDE CHAIN' 9 4 ARG A 30 ? ? 0.085 'SIDE CHAIN' 10 6 ARG A 56 ? ? 0.170 'SIDE CHAIN' 11 7 ARG A 56 ? ? 0.085 'SIDE CHAIN' 12 9 ARG A 56 ? ? 0.079 'SIDE CHAIN' 13 9 PHE A 67 ? ? 0.078 'SIDE CHAIN' 14 14 TYR A 34 ? ? 0.120 'SIDE CHAIN' 15 15 ARG A 56 ? ? 0.078 'SIDE CHAIN' 16 17 ARG A 11 ? ? 0.114 'SIDE CHAIN' 17 18 TYR A 48 ? ? 0.091 'SIDE CHAIN' 18 20 TYR A 34 ? ? 0.102 'SIDE CHAIN' 19 21 TYR A 34 ? ? 0.081 'SIDE CHAIN' 20 24 ARG A 11 ? ? 0.089 'SIDE CHAIN' 21 24 TYR A 34 ? ? 0.165 'SIDE CHAIN' 22 24 ARG A 56 ? ? 0.087 'SIDE CHAIN' 23 26 ARG A 56 ? ? 0.094 'SIDE CHAIN' 24 27 ARG A 11 ? ? 0.114 'SIDE CHAIN' 25 27 PHE A 67 ? ? 0.083 'SIDE CHAIN' 26 28 TYR A 34 ? ? 0.110 'SIDE CHAIN' 27 29 ARG A 56 ? ? 0.122 'SIDE CHAIN' 28 30 ARG A 30 ? ? 0.078 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1YJV _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1YJV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.8mM 15N labeled sample; 5mM DTT; 100mM phosphate buffer' '90% H2O/10% D2O' 2 '0.8mM 15N 13C labeled sample; 5mM DTT; 100mM phosphate buffer' '90% H2O/10% D2O' 3 '1.0mM unlabeled sample; 5mM DTT; 100mM phosphate buffer' '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 2 'CBCANH; CBCACONH; HNCO; HNCACO' 2 3 3 '2D NOESY' 3 4 3 '2D TOCSY' 3 5 1 HNHA 1 # _pdbx_nmr_refine.entry_id 1YJV _pdbx_nmr_refine.method 'torsion angle dynamics coupled with simulated annealing followed by restrained energy minimization' _pdbx_nmr_refine.details 'the structures were based on a total of 1947 meaningful distance constraints, 81 dihedral angle restraints' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR ? ? 1 'data analysis' CARA 1.2 'Keller, Rochus (2004): the computer aided resonance tutorial ISBN 3-85600-112-3, first edition' 2 'structure solution' DYANA 1.5 ? 3 refinement Amber 5.0 ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU1 CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLU N N N N 89 GLU CA C N S 90 GLU C C N N 91 GLU O O N N 92 GLU CB C N N 93 GLU CG C N N 94 GLU CD C N N 95 GLU OE1 O N N 96 GLU OE2 O N N 97 GLU OXT O N N 98 GLU H H N N 99 GLU H2 H N N 100 GLU HA H N N 101 GLU HB2 H N N 102 GLU HB3 H N N 103 GLU HG2 H N N 104 GLU HG3 H N N 105 GLU HE2 H N N 106 GLU HXT H N N 107 GLY N N N N 108 GLY CA C N N 109 GLY C C N N 110 GLY O O N N 111 GLY OXT O N N 112 GLY H H N N 113 GLY H2 H N N 114 GLY HA2 H N N 115 GLY HA3 H N N 116 GLY HXT H N N 117 HIS N N N N 118 HIS CA C N S 119 HIS C C N N 120 HIS O O N N 121 HIS CB C N N 122 HIS CG C Y N 123 HIS ND1 N Y N 124 HIS CD2 C Y N 125 HIS CE1 C Y N 126 HIS NE2 N Y N 127 HIS OXT O N N 128 HIS H H N N 129 HIS H2 H N N 130 HIS HA H N N 131 HIS HB2 H N N 132 HIS HB3 H N N 133 HIS HD1 H N N 134 HIS HD2 H N N 135 HIS HE1 H N N 136 HIS HE2 H N N 137 HIS HXT H N N 138 ILE N N N N 139 ILE CA C N S 140 ILE C C N N 141 ILE O O N N 142 ILE CB C N S 143 ILE CG1 C N N 144 ILE CG2 C N N 145 ILE CD1 C N N 146 ILE OXT O N N 147 ILE H H N N 148 ILE H2 H N N 149 ILE HA H N N 150 ILE HB H N N 151 ILE HG12 H N N 152 ILE HG13 H N N 153 ILE HG21 H N N 154 ILE HG22 H N N 155 ILE HG23 H N N 156 ILE HD11 H N N 157 ILE HD12 H N N 158 ILE HD13 H N N 159 ILE HXT H N N 160 LEU N N N N 161 LEU CA C N S 162 LEU C C N N 163 LEU O O N N 164 LEU CB C N N 165 LEU CG C N N 166 LEU CD1 C N N 167 LEU CD2 C N N 168 LEU OXT O N N 169 LEU H H N N 170 LEU H2 H N N 171 LEU HA H N N 172 LEU HB2 H N N 173 LEU HB3 H N N 174 LEU HG H N N 175 LEU HD11 H N N 176 LEU HD12 H N N 177 LEU HD13 H N N 178 LEU HD21 H N N 179 LEU HD22 H N N 180 LEU HD23 H N N 181 LEU HXT H N N 182 LYS N N N N 183 LYS CA C N S 184 LYS C C N N 185 LYS O O N N 186 LYS CB C N N 187 LYS CG C N N 188 LYS CD C N N 189 LYS CE C N N 190 LYS NZ N N N 191 LYS OXT O N N 192 LYS H H N N 193 LYS H2 H N N 194 LYS HA H N N 195 LYS HB2 H N N 196 LYS HB3 H N N 197 LYS HG2 H N N 198 LYS HG3 H N N 199 LYS HD2 H N N 200 LYS HD3 H N N 201 LYS HE2 H N N 202 LYS HE3 H N N 203 LYS HZ1 H N N 204 LYS HZ2 H N N 205 LYS HZ3 H N N 206 LYS HXT H N N 207 MET N N N N 208 MET CA C N S 209 MET C C N N 210 MET O O N N 211 MET CB C N N 212 MET CG C N N 213 MET SD S N N 214 MET CE C N N 215 MET OXT O N N 216 MET H H N N 217 MET H2 H N N 218 MET HA H N N 219 MET HB2 H N N 220 MET HB3 H N N 221 MET HG2 H N N 222 MET HG3 H N N 223 MET HE1 H N N 224 MET HE2 H N N 225 MET HE3 H N N 226 MET HXT H N N 227 PHE N N N N 228 PHE CA C N S 229 PHE C C N N 230 PHE O O N N 231 PHE CB C N N 232 PHE CG C Y N 233 PHE CD1 C Y N 234 PHE CD2 C Y N 235 PHE CE1 C Y N 236 PHE CE2 C Y N 237 PHE CZ C Y N 238 PHE OXT O N N 239 PHE H H N N 240 PHE H2 H N N 241 PHE HA H N N 242 PHE HB2 H N N 243 PHE HB3 H N N 244 PHE HD1 H N N 245 PHE HD2 H N N 246 PHE HE1 H N N 247 PHE HE2 H N N 248 PHE HZ H N N 249 PHE HXT H N N 250 PRO N N N N 251 PRO CA C N S 252 PRO C C N N 253 PRO O O N N 254 PRO CB C N N 255 PRO CG C N N 256 PRO CD C N N 257 PRO OXT O N N 258 PRO H H N N 259 PRO HA H N N 260 PRO HB2 H N N 261 PRO HB3 H N N 262 PRO HG2 H N N 263 PRO HG3 H N N 264 PRO HD2 H N N 265 PRO HD3 H N N 266 PRO HXT H N N 267 SER N N N N 268 SER CA C N S 269 SER C C N N 270 SER O O N N 271 SER CB C N N 272 SER OG O N N 273 SER OXT O N N 274 SER H H N N 275 SER H2 H N N 276 SER HA H N N 277 SER HB2 H N N 278 SER HB3 H N N 279 SER HG H N N 280 SER HXT H N N 281 THR N N N N 282 THR CA C N S 283 THR C C N N 284 THR O O N N 285 THR CB C N R 286 THR OG1 O N N 287 THR CG2 C N N 288 THR OXT O N N 289 THR H H N N 290 THR H2 H N N 291 THR HA H N N 292 THR HB H N N 293 THR HG1 H N N 294 THR HG21 H N N 295 THR HG22 H N N 296 THR HG23 H N N 297 THR HXT H N N 298 TYR N N N N 299 TYR CA C N S 300 TYR C C N N 301 TYR O O N N 302 TYR CB C N N 303 TYR CG C Y N 304 TYR CD1 C Y N 305 TYR CD2 C Y N 306 TYR CE1 C Y N 307 TYR CE2 C Y N 308 TYR CZ C Y N 309 TYR OH O N N 310 TYR OXT O N N 311 TYR H H N N 312 TYR H2 H N N 313 TYR HA H N N 314 TYR HB2 H N N 315 TYR HB3 H N N 316 TYR HD1 H N N 317 TYR HD2 H N N 318 TYR HE1 H N N 319 TYR HE2 H N N 320 TYR HH H N N 321 TYR HXT H N N 322 VAL N N N N 323 VAL CA C N S 324 VAL C C N N 325 VAL O O N N 326 VAL CB C N N 327 VAL CG1 C N N 328 VAL CG2 C N N 329 VAL OXT O N N 330 VAL H H N N 331 VAL H2 H N N 332 VAL HA H N N 333 VAL HB H N N 334 VAL HG11 H N N 335 VAL HG12 H N N 336 VAL HG13 H N N 337 VAL HG21 H N N 338 VAL HG22 H N N 339 VAL HG23 H N N 340 VAL HXT H N N 341 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 900 ? 2 AVANCE Bruker 500 ? # _atom_sites.entry_id 1YJV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU H N O S # loop_