data_1YL2 # _entry.id 1YL2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1YL2 RCSB RCSB031638 WWPDB D_1000031638 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.pdb_id 2CA7 _pdbx_database_PDB_obs_spr.replace_pdb_id 1YL2 _pdbx_database_PDB_obs_spr.date 2008-07-15 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.entry_id 1YL2 _pdbx_database_status.status_code OBS _pdbx_database_status.recvd_initial_deposition_date 2005-01-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr OBS _pdbx_database_status.SG_entry N _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bayrhuber, M.' 1 'Vijayan, V.' 2 'Ferber, M.' 3 'Graf, R.' 4 'Korukottu, J.' 5 'Olivera, B.M.' 6 'Terlau, H.' 7 'Zweckstetter, M.' 8 'Becker, S.' 9 # _citation.id primary _citation.title 'Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family. Structural and functional characterization.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 23766 _citation.page_last 23770 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15833744 _citation.pdbx_database_id_DOI 10.1074/jbc.C500064200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bayrhuber, M.' 1 primary 'Vijayan, V.' 2 primary 'Ferber, M.' 3 primary 'Graf, R.' 4 primary 'Korukottu, J.' 5 primary 'Imperial, J.' 6 primary 'Garrett, J.E.' 7 primary 'Olivera, B.M.' 8 primary 'Terlau, H.' 9 primary 'Zweckstetter, M.' 10 primary 'Becker, S.' 11 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Conkunitzin-S1 _entity.formula_weight 6944.685 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCLYT _entity_poly.pdbx_seq_one_letter_code_can KDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCLYT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 ASP n 1 3 ARG n 1 4 PRO n 1 5 SER n 1 6 LEU n 1 7 CYS n 1 8 ASP n 1 9 LEU n 1 10 PRO n 1 11 ALA n 1 12 ASP n 1 13 SER n 1 14 GLY n 1 15 SER n 1 16 GLY n 1 17 THR n 1 18 LYS n 1 19 ALA n 1 20 GLU n 1 21 LYS n 1 22 ARG n 1 23 ILE n 1 24 TYR n 1 25 TYR n 1 26 ASN n 1 27 SER n 1 28 ALA n 1 29 ARG n 1 30 LYS n 1 31 GLN n 1 32 CYS n 1 33 LEU n 1 34 ARG n 1 35 PHE n 1 36 ASP n 1 37 TYR n 1 38 THR n 1 39 GLY n 1 40 GLN n 1 41 GLY n 1 42 GLY n 1 43 ASN n 1 44 GLU n 1 45 ASN n 1 46 ASN n 1 47 PHE n 1 48 ARG n 1 49 ARG n 1 50 THR n 1 51 TYR n 1 52 ASP n 1 53 CYS n 1 54 GLN n 1 55 ARG n 1 56 THR n 1 57 CYS n 1 58 LEU n 1 59 TYR n 1 60 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'striated cone' _entity_src_gen.gene_src_genus Conus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Conus striatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6493 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTWIN _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM U-15N,13C; 100mM sodium acetate buffer, pH 5.2' '90% H2O/10% D2O' 2 '0.5mM U-15N, 100mM sodium acetate buffer, pH 5.2' '90% H2O/10% D2O' 3 '0.5mM U-15N,13C; 100mM sodium acetate buffer, pH 5.2' '85.5% H20, 9.5% D2O, 4.3% pentaethylene glycol monododecyl ether, 0.7% n-hexanol' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 600 ? 2 Avance Bruker 600 ? 3 Avance Bruker 700 ? 4 Avance Bruker 800 ? 5 Avance Bruker 900 ? # _pdbx_nmr_refine.entry_id 1YL2 _pdbx_nmr_refine.method ;molecular dynamics, simulated annealing, torsion angle dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1YL2 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1YL2 _pdbx_nmr_representative.conformer_id 17 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XWINNMR 3.5 'Bruker BioSpin GmbH' 1 processing NMRPipe 97.027.12.56 'Delaglio, F., Grzesiek, S., Vuister, G. W., Zhu, G., Pfeifer, J., and Bax, A.' 2 processing NMRDraw '2.3 Rev 2004.245.17.31' 'Delaglio, F., Grzesiek, S., Vuister, G. W., Zhu, G., Pfeifer, J., and Bax, A.' 3 'data analysis' Sparky 3.110 'Goddard, T. D., Kneller, D. G' 4 'structure solution' ARIA 2alpha 'Habeck, M., Rieping, W., Linge, J., and Nilges, M.' 5 'data analysis' MARS 1.0 'Jung, Y. S., and Zweckstetter, M.' 6 refinement CYANA 2.0.32 'Herrmann, T., Guntert, P., and Wuthrich, K.' 7 # _exptl.entry_id 1YL2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1YL2 _struct.title 'Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family- Structural and functional characterization' _struct.pdbx_descriptor Conkunitzin-S1 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YL2 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'neurotoxin; Kunitz-domain; potassium channel blocker, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 4 ? LEU A 9 ? PRO A 4 LEU A 9 5 ? 6 HELX_P HELX_P2 2 ARG A 49 ? TYR A 59 ? ARG A 49 TYR A 59 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 57 SG ? ? A CYS 7 A CYS 57 1_555 ? ? ? ? ? ? ? 2.029 ? disulf2 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 32 A CYS 53 1_555 ? ? ? ? ? ? ? 2.046 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 20 ? ASN A 26 ? GLU A 20 ASN A 26 A 2 GLN A 31 ? TYR A 37 ? GLN A 31 TYR A 37 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # _atom_sites.entry_id 1YL2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 THR 60 60 60 THR THR A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-04-26 2 'Structure model' 1 1 2008-07-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG3 A LYS 21 ? ? HE A ARG 34 ? ? 1.30 2 5 HD13 A LEU 9 ? ? HB3 A ASN 45 ? ? 1.23 3 12 HG3 A LYS 21 ? ? HE A ARG 34 ? ? 1.30 4 13 HD13 A LEU 9 ? ? HB3 A ASN 45 ? ? 1.23 5 15 HG3 A LYS 21 ? ? HE A ARG 34 ? ? 1.30 6 19 HG3 A LYS 21 ? ? HE A ARG 34 ? ? 1.30 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? 72.34 -61.80 2 1 PRO A 10 ? ? -21.45 102.51 3 1 ALA A 11 ? ? -59.24 95.14 4 2 ARG A 3 ? ? 73.89 132.47 5 2 PRO A 4 ? ? -49.11 156.41 6 2 ALA A 11 ? ? -58.68 95.62 7 3 ALA A 11 ? ? -61.85 88.42 8 4 ARG A 3 ? ? 55.61 152.18 9 4 PRO A 10 ? ? -69.48 94.02 10 4 ALA A 11 ? ? -58.61 96.98 11 5 ALA A 11 ? ? -63.92 83.54 12 7 ARG A 3 ? ? 73.89 132.47 13 7 PRO A 4 ? ? -49.11 156.41 14 7 ALA A 11 ? ? -58.68 95.62 15 8 ALA A 11 ? ? -61.85 88.42 16 10 ARG A 3 ? ? 73.89 132.47 17 10 PRO A 4 ? ? -49.11 156.41 18 10 ALA A 11 ? ? -58.68 95.62 19 11 ARG A 3 ? ? 55.61 152.18 20 11 PRO A 10 ? ? -69.48 94.02 21 11 ALA A 11 ? ? -58.61 96.98 22 12 ASP A 2 ? ? 72.34 -61.80 23 12 PRO A 10 ? ? -21.45 102.51 24 12 ALA A 11 ? ? -59.24 95.14 25 13 ALA A 11 ? ? -63.92 83.54 26 14 ARG A 3 ? ? 73.89 132.47 27 14 PRO A 4 ? ? -49.11 156.41 28 14 ALA A 11 ? ? -58.68 95.62 29 15 ASP A 2 ? ? 72.34 -61.80 30 15 PRO A 10 ? ? -21.45 102.51 31 15 ALA A 11 ? ? -59.24 95.14 32 16 ARG A 3 ? ? 55.61 152.18 33 16 PRO A 10 ? ? -69.48 94.02 34 16 ALA A 11 ? ? -58.61 96.98 35 18 ARG A 3 ? ? 73.89 132.47 36 18 PRO A 4 ? ? -49.11 156.41 37 18 ALA A 11 ? ? -58.68 95.62 38 19 ASP A 2 ? ? 72.34 -61.80 39 19 PRO A 10 ? ? -21.45 102.51 40 19 ALA A 11 ? ? -59.24 95.14 41 20 ARG A 3 ? ? 73.89 132.47 42 20 PRO A 4 ? ? -49.11 156.41 43 20 ALA A 11 ? ? -58.68 95.62 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 ARG A 29 ? ? 0.075 'SIDE CHAIN' 2 6 ARG A 49 ? ? 0.077 'SIDE CHAIN' 3 9 ARG A 49 ? ? 0.077 'SIDE CHAIN' 4 13 ARG A 29 ? ? 0.075 'SIDE CHAIN' 5 17 ARG A 49 ? ? 0.077 'SIDE CHAIN' #