data_1YSF # _entry.id 1YSF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YSF pdb_00001ysf 10.2210/pdb1ysf/pdb RCSB RCSB031877 ? ? WWPDB D_1000031877 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1EKT . unspecified PDB 1YFB 'Regularized average structure' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YSF _pdbx_database_status.recvd_initial_deposition_date 2005-02-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry N _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Truffault, V.' 1 'Djuranovic, S.' 2 'Coles, M.' 3 # _citation.id primary _citation.title 'AbrB-like transcription factors assume a swapped hairpin fold that is evolutionarily related to double-psi beta barrels.' _citation.journal_abbrev Structure _citation.journal_volume 13 _citation.page_first 919 _citation.page_last 928 _citation.year 2005 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15939023 _citation.pdbx_database_id_DOI 10.1016/j.str.2005.03.017 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Coles, M.' 1 ? primary 'Djuranovic, S.' 2 ? primary 'Soding, J.' 3 ? primary 'Frickey, T.' 4 ? primary 'Koretke, K.' 5 ? primary 'Truffault, V.' 6 ? primary 'Martin, J.' 7 ? primary 'Lupas, A.N.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transition state regulatory protein abrB' _entity.formula_weight 6986.237 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MHHHHHHFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN _entity_poly.pdbx_seq_one_letter_code_can MHHHHHHFMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 PHE n 1 9 MET n 1 10 LYS n 1 11 SER n 1 12 THR n 1 13 GLY n 1 14 ILE n 1 15 VAL n 1 16 ARG n 1 17 LYS n 1 18 VAL n 1 19 ASP n 1 20 GLU n 1 21 LEU n 1 22 GLY n 1 23 ARG n 1 24 VAL n 1 25 VAL n 1 26 ILE n 1 27 PRO n 1 28 ILE n 1 29 GLU n 1 30 LEU n 1 31 ARG n 1 32 ARG n 1 33 THR n 1 34 LEU n 1 35 GLY n 1 36 ILE n 1 37 ALA n 1 38 GLU n 1 39 LYS n 1 40 ASP n 1 41 ALA n 1 42 LEU n 1 43 GLU n 1 44 ILE n 1 45 TYR n 1 46 VAL n 1 47 ASP n 1 48 ASP n 1 49 GLU n 1 50 LYS n 1 51 ILE n 1 52 ILE n 1 53 LEU n 1 54 LYS n 1 55 LYS n 1 56 TYR n 1 57 LYS n 1 58 PRO n 1 59 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ABRB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet30b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code ABRB_BACSU _struct_ref.pdbx_db_accession P08874 _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_seq_one_letter_code FMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1YSF A 8 ? 59 ? P08874 2 ? 53 ? 2 53 2 1 1YSF B 8 ? 59 ? P08874 2 ? 53 ? 2 53 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1YSF MET A 1 ? UNP P08874 ? ? 'expression tag' -5 1 1 1YSF HIS A 2 ? UNP P08874 ? ? 'expression tag' -4 2 1 1YSF HIS A 3 ? UNP P08874 ? ? 'expression tag' -3 3 1 1YSF HIS A 4 ? UNP P08874 ? ? 'expression tag' -2 4 1 1YSF HIS A 5 ? UNP P08874 ? ? 'expression tag' -1 5 1 1YSF HIS A 6 ? UNP P08874 ? ? 'expression tag' 0 6 1 1YSF HIS A 7 ? UNP P08874 ? ? 'expression tag' 1 7 2 1YSF MET B 1 ? UNP P08874 ? ? 'expression tag' -5 8 2 1YSF HIS B 2 ? UNP P08874 ? ? 'expression tag' -4 9 2 1YSF HIS B 3 ? UNP P08874 ? ? 'expression tag' -3 10 2 1YSF HIS B 4 ? UNP P08874 ? ? 'expression tag' -2 11 2 1YSF HIS B 5 ? UNP P08874 ? ? 'expression tag' -1 12 2 1YSF HIS B 6 ? UNP P08874 ? ? 'expression tag' 0 13 2 1YSF HIS B 7 ? UNP P08874 ? ? 'expression tag' 1 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 2 2 1 '2D NOESY' 1 3 1 HNHA 2 4 1 '13C-filtered/edited NOESY' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 305 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 80mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.5mM AbrB-N; 20mM phosphate buffer; 80mM KCl' '90% H2O/10% D2O' 2 '0.5mM AbrB-N U-15N; 20mM phosphate buffer; 80mM KCl' '90% H2O/10% D2O' 3 '0.25mM AbrB-N U-15N, 0.25mM AbrB-N U-13C; 20mM phosphate buffer; 80mM KCl' '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 600 ? 2 DMX Bruker 750 ? 3 DMX Bruker 900 ? # _pdbx_nmr_refine.entry_id 1YSF _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1YSF _pdbx_nmr_details.text 'INTERMOLECULAR CONTACTS IDENTIFIED USING A DIFFERENTIALLY 15N/13C LABELLED DIMER SAMPLE' # _pdbx_nmr_ensemble.entry_id 1YSF _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 22 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST RESTRAINT VIOLATIONS' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1YSF _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' X-PLOR NIH-2.9.7 'BRUNGER, A.T.' 1 collection XwinNMR 3.5 Bruker 2 processing XwinNMR 3.5 Bruker 3 'data analysis' NMRView 5.0.15 'Johnson, B.A.' 4 refinement X-PLOR NIH-2.9.7 'BRUNGER, A.T.' 5 # _exptl.entry_id 1YSF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1YSF _struct.title 'The solution structure of the N-domain of the transcription factor abrB' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YSF _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'NMR; HOMODIMER; BIOINFORMATICS; SWAPPED-HAIRPIN BARREL, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 27 ? LEU A 34 ? PRO A 21 LEU A 28 1 ? 8 HELX_P HELX_P2 2 PRO B 27 ? LEU B 34 ? PRO B 21 LEU B 28 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 14 ? LYS A 17 ? ILE A 8 LYS A 11 A 2 ALA B 41 ? ASP B 47 ? ALA B 35 ASP B 41 A 3 LYS B 50 ? LYS B 55 ? LYS B 44 LYS B 49 A 4 LYS A 50 ? LYS A 55 ? LYS A 44 LYS A 49 A 5 ALA A 41 ? ASP A 47 ? ALA A 35 ASP A 41 A 6 ILE B 14 ? LYS B 17 ? ILE B 8 LYS B 11 B 1 ARG A 23 ? VAL A 25 ? ARG A 17 VAL A 19 B 2 ARG B 23 ? VAL B 25 ? ARG B 17 VAL B 19 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 14 ? N ILE A 8 O ILE B 44 ? O ILE B 38 A 2 3 N ASP B 47 ? N ASP B 41 O LYS B 50 ? O LYS B 44 A 3 4 O ILE B 51 ? O ILE B 45 N LEU A 53 ? N LEU A 47 A 4 5 O LYS A 50 ? O LYS A 44 N ASP A 47 ? N ASP A 41 A 5 6 N ILE A 44 ? N ILE A 38 O ILE B 14 ? O ILE B 8 B 1 2 N VAL A 24 ? N VAL A 18 O VAL B 24 ? O VAL B 18 # _atom_sites.entry_id 1YSF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -5 ? ? ? A . n A 1 2 HIS 2 -4 ? ? ? A . n A 1 3 HIS 3 -3 ? ? ? A . n A 1 4 HIS 4 -2 ? ? ? A . n A 1 5 HIS 5 -1 ? ? ? A . n A 1 6 HIS 6 0 ? ? ? A . n A 1 7 HIS 7 1 ? ? ? A . n A 1 8 PHE 8 2 2 PHE PHE A . n A 1 9 MET 9 3 3 MET MET A . n A 1 10 LYS 10 4 4 LYS LYS A . n A 1 11 SER 11 5 5 SER SER A . n A 1 12 THR 12 6 6 THR THR A . n A 1 13 GLY 13 7 7 GLY GLY A . n A 1 14 ILE 14 8 8 ILE ILE A . n A 1 15 VAL 15 9 9 VAL VAL A . n A 1 16 ARG 16 10 10 ARG ARG A . n A 1 17 LYS 17 11 11 LYS LYS A . n A 1 18 VAL 18 12 12 VAL VAL A . n A 1 19 ASP 19 13 13 ASP ASP A . n A 1 20 GLU 20 14 14 GLU GLU A . n A 1 21 LEU 21 15 15 LEU LEU A . n A 1 22 GLY 22 16 16 GLY GLY A . n A 1 23 ARG 23 17 17 ARG ARG A . n A 1 24 VAL 24 18 18 VAL VAL A . n A 1 25 VAL 25 19 19 VAL VAL A . n A 1 26 ILE 26 20 20 ILE ILE A . n A 1 27 PRO 27 21 21 PRO PRO A . n A 1 28 ILE 28 22 22 ILE ILE A . n A 1 29 GLU 29 23 23 GLU GLU A . n A 1 30 LEU 30 24 24 LEU LEU A . n A 1 31 ARG 31 25 25 ARG ARG A . n A 1 32 ARG 32 26 26 ARG ARG A . n A 1 33 THR 33 27 27 THR THR A . n A 1 34 LEU 34 28 28 LEU LEU A . n A 1 35 GLY 35 29 29 GLY GLY A . n A 1 36 ILE 36 30 30 ILE ILE A . n A 1 37 ALA 37 31 31 ALA ALA A . n A 1 38 GLU 38 32 32 GLU GLU A . n A 1 39 LYS 39 33 33 LYS LYS A . n A 1 40 ASP 40 34 34 ASP ASP A . n A 1 41 ALA 41 35 35 ALA ALA A . n A 1 42 LEU 42 36 36 LEU LEU A . n A 1 43 GLU 43 37 37 GLU GLU A . n A 1 44 ILE 44 38 38 ILE ILE A . n A 1 45 TYR 45 39 39 TYR TYR A . n A 1 46 VAL 46 40 40 VAL VAL A . n A 1 47 ASP 47 41 41 ASP ASP A . n A 1 48 ASP 48 42 42 ASP ASP A . n A 1 49 GLU 49 43 43 GLU GLU A . n A 1 50 LYS 50 44 44 LYS LYS A . n A 1 51 ILE 51 45 45 ILE ILE A . n A 1 52 ILE 52 46 46 ILE ILE A . n A 1 53 LEU 53 47 47 LEU LEU A . n A 1 54 LYS 54 48 48 LYS LYS A . n A 1 55 LYS 55 49 49 LYS LYS A . n A 1 56 TYR 56 50 50 TYR TYR A . n A 1 57 LYS 57 51 51 LYS LYS A . n A 1 58 PRO 58 52 52 PRO PRO A . n A 1 59 ASN 59 53 53 ASN ASN A . n B 1 1 MET 1 -5 ? ? ? B . n B 1 2 HIS 2 -4 ? ? ? B . n B 1 3 HIS 3 -3 ? ? ? B . n B 1 4 HIS 4 -2 ? ? ? B . n B 1 5 HIS 5 -1 ? ? ? B . n B 1 6 HIS 6 0 ? ? ? B . n B 1 7 HIS 7 1 ? ? ? B . n B 1 8 PHE 8 2 2 PHE PHE B . n B 1 9 MET 9 3 3 MET MET B . n B 1 10 LYS 10 4 4 LYS LYS B . n B 1 11 SER 11 5 5 SER SER B . n B 1 12 THR 12 6 6 THR THR B . n B 1 13 GLY 13 7 7 GLY GLY B . n B 1 14 ILE 14 8 8 ILE ILE B . n B 1 15 VAL 15 9 9 VAL VAL B . n B 1 16 ARG 16 10 10 ARG ARG B . n B 1 17 LYS 17 11 11 LYS LYS B . n B 1 18 VAL 18 12 12 VAL VAL B . n B 1 19 ASP 19 13 13 ASP ASP B . n B 1 20 GLU 20 14 14 GLU GLU B . n B 1 21 LEU 21 15 15 LEU LEU B . n B 1 22 GLY 22 16 16 GLY GLY B . n B 1 23 ARG 23 17 17 ARG ARG B . n B 1 24 VAL 24 18 18 VAL VAL B . n B 1 25 VAL 25 19 19 VAL VAL B . n B 1 26 ILE 26 20 20 ILE ILE B . n B 1 27 PRO 27 21 21 PRO PRO B . n B 1 28 ILE 28 22 22 ILE ILE B . n B 1 29 GLU 29 23 23 GLU GLU B . n B 1 30 LEU 30 24 24 LEU LEU B . n B 1 31 ARG 31 25 25 ARG ARG B . n B 1 32 ARG 32 26 26 ARG ARG B . n B 1 33 THR 33 27 27 THR THR B . n B 1 34 LEU 34 28 28 LEU LEU B . n B 1 35 GLY 35 29 29 GLY GLY B . n B 1 36 ILE 36 30 30 ILE ILE B . n B 1 37 ALA 37 31 31 ALA ALA B . n B 1 38 GLU 38 32 32 GLU GLU B . n B 1 39 LYS 39 33 33 LYS LYS B . n B 1 40 ASP 40 34 34 ASP ASP B . n B 1 41 ALA 41 35 35 ALA ALA B . n B 1 42 LEU 42 36 36 LEU LEU B . n B 1 43 GLU 43 37 37 GLU GLU B . n B 1 44 ILE 44 38 38 ILE ILE B . n B 1 45 TYR 45 39 39 TYR TYR B . n B 1 46 VAL 46 40 40 VAL VAL B . n B 1 47 ASP 47 41 41 ASP ASP B . n B 1 48 ASP 48 42 42 ASP ASP B . n B 1 49 GLU 49 43 43 GLU GLU B . n B 1 50 LYS 50 44 44 LYS LYS B . n B 1 51 ILE 51 45 45 ILE ILE B . n B 1 52 ILE 52 46 46 ILE ILE B . n B 1 53 LEU 53 47 47 LEU LEU B . n B 1 54 LYS 54 48 48 LYS LYS B . n B 1 55 LYS 55 49 49 LYS LYS B . n B 1 56 TYR 56 50 50 TYR TYR B . n B 1 57 LYS 57 51 51 LYS LYS B . n B 1 58 PRO 58 52 52 PRO PRO B . n B 1 59 ASN 59 53 53 ASN ASN B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-04-12 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 33 ? ? 74.81 -4.57 2 1 GLU A 43 ? ? 58.55 14.05 3 1 LYS B 33 ? ? 74.84 -4.77 4 1 GLU B 43 ? ? 58.41 14.01 5 2 LYS A 33 ? ? 74.35 -4.35 6 2 SER B 5 ? ? -71.92 -93.64 7 2 LYS B 33 ? ? 74.42 -4.64 8 3 LYS A 33 ? ? 74.65 -4.92 9 3 GLU A 43 ? ? 57.40 15.71 10 3 LYS B 33 ? ? 74.69 -5.01 11 3 GLU B 43 ? ? 57.23 15.61 12 4 LYS A 33 ? ? 74.83 -4.62 13 4 GLU A 43 ? ? 56.99 16.91 14 4 LYS B 33 ? ? 74.88 -4.91 15 4 GLU B 43 ? ? 56.85 16.89 16 5 THR A 6 ? ? -170.24 64.40 17 5 LYS A 33 ? ? 74.43 -4.34 18 5 THR B 6 ? ? -170.84 64.52 19 5 LYS B 33 ? ? 74.49 -4.58 20 6 LYS A 33 ? ? 74.57 -4.62 21 6 SER B 5 ? ? -97.58 -94.59 22 6 LYS B 33 ? ? 74.66 -4.78 23 7 LYS A 33 ? ? 74.39 -4.47 24 7 GLU A 43 ? ? 57.84 14.46 25 7 LYS B 33 ? ? 74.59 -4.76 26 7 GLU B 43 ? ? 57.61 14.53 27 8 LYS A 33 ? ? 74.00 -4.35 28 8 GLU A 43 ? ? 58.87 14.09 29 8 SER B 5 ? ? -73.87 -93.16 30 8 LYS B 33 ? ? 74.13 -4.49 31 8 GLU B 43 ? ? 58.79 14.03 32 9 LYS A 33 ? ? 74.86 -4.68 33 9 GLU A 43 ? ? 59.95 12.69 34 9 THR B 6 ? ? -147.68 -42.68 35 9 LYS B 33 ? ? 74.99 -4.90 36 9 GLU B 43 ? ? 59.85 12.73 37 9 LYS B 51 ? ? -119.74 75.67 38 10 LYS A 33 ? ? 74.46 -4.64 39 10 LYS B 33 ? ? 74.63 -4.76 40 11 LYS A 4 ? ? -101.70 43.15 41 11 LYS A 33 ? ? 74.96 -4.95 42 11 LYS B 33 ? ? 75.03 -5.16 43 12 LYS A 33 ? ? 74.22 -4.58 44 12 LYS B 33 ? ? 74.40 -4.89 45 13 MET A 3 ? ? -93.76 -89.38 46 13 LYS A 33 ? ? 74.59 -4.56 47 13 GLU A 43 ? ? 56.53 16.18 48 13 LYS B 33 ? ? 74.67 -4.73 49 13 GLU B 43 ? ? 56.32 16.12 50 14 THR A 6 ? ? -170.80 63.58 51 14 LYS A 33 ? ? 74.91 -4.70 52 14 GLU A 43 ? ? 59.10 13.60 53 14 MET B 3 ? ? -97.09 43.68 54 14 THR B 6 ? ? -168.72 63.55 55 14 LYS B 33 ? ? 75.00 -4.94 56 14 GLU B 43 ? ? 58.95 13.63 57 15 LYS A 33 ? ? 67.16 -3.32 58 15 LYS B 33 ? ? 66.57 -2.74 59 16 LYS A 33 ? ? 74.52 -4.63 60 16 LYS B 33 ? ? 74.54 -4.78 61 17 LYS A 33 ? ? 74.78 -4.97 62 17 SER B 5 ? ? -107.59 -100.14 63 17 LYS B 33 ? ? 74.76 -5.00 64 17 LYS B 51 ? ? -119.47 78.07 65 18 LYS A 33 ? ? 74.70 -4.58 66 18 GLU A 43 ? ? 59.05 14.07 67 18 LYS B 33 ? ? 74.71 -4.69 68 18 GLU B 43 ? ? 58.89 14.04 69 18 LYS B 51 ? ? -109.08 77.10 70 19 LYS A 33 ? ? 75.02 -4.63 71 19 GLU A 43 ? ? 57.67 14.55 72 19 SER B 5 ? ? -66.29 -99.32 73 19 LYS B 33 ? ? 75.07 -4.87 74 19 GLU B 43 ? ? 57.42 14.65 75 20 LYS A 33 ? ? 67.01 -2.97 76 20 GLU A 43 ? ? 58.74 13.77 77 20 LYS B 33 ? ? 66.52 -2.51 78 20 GLU B 43 ? ? 58.55 13.85 79 21 THR A 6 ? ? -171.00 62.51 80 21 LYS A 33 ? ? 74.25 -4.52 81 21 GLU A 43 ? ? 56.57 15.99 82 21 LYS B 4 ? ? -78.34 -84.59 83 21 THR B 6 ? ? -170.49 62.39 84 21 LYS B 33 ? ? 74.27 -4.56 85 21 GLU B 43 ? ? 56.26 16.11 86 22 MET A 3 ? ? -64.74 -77.05 87 22 THR A 6 ? ? -172.44 62.88 88 22 LYS A 33 ? ? 74.34 -4.24 89 22 THR B 6 ? ? -169.23 62.80 90 22 LYS B 33 ? ? 74.34 -4.29 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -5 ? A MET 1 2 1 Y 1 A HIS -4 ? A HIS 2 3 1 Y 1 A HIS -3 ? A HIS 3 4 1 Y 1 A HIS -2 ? A HIS 4 5 1 Y 1 A HIS -1 ? A HIS 5 6 1 Y 1 A HIS 0 ? A HIS 6 7 1 Y 1 A HIS 1 ? A HIS 7 8 1 Y 1 B MET -5 ? B MET 1 9 1 Y 1 B HIS -4 ? B HIS 2 10 1 Y 1 B HIS -3 ? B HIS 3 11 1 Y 1 B HIS -2 ? B HIS 4 12 1 Y 1 B HIS -1 ? B HIS 5 13 1 Y 1 B HIS 0 ? B HIS 6 14 1 Y 1 B HIS 1 ? B HIS 7 15 2 Y 1 A MET -5 ? A MET 1 16 2 Y 1 A HIS -4 ? A HIS 2 17 2 Y 1 A HIS -3 ? A HIS 3 18 2 Y 1 A HIS -2 ? A HIS 4 19 2 Y 1 A HIS -1 ? A HIS 5 20 2 Y 1 A HIS 0 ? A HIS 6 21 2 Y 1 A HIS 1 ? A HIS 7 22 2 Y 1 B MET -5 ? B MET 1 23 2 Y 1 B HIS -4 ? B HIS 2 24 2 Y 1 B HIS -3 ? B HIS 3 25 2 Y 1 B HIS -2 ? B HIS 4 26 2 Y 1 B HIS -1 ? B HIS 5 27 2 Y 1 B HIS 0 ? B HIS 6 28 2 Y 1 B HIS 1 ? B HIS 7 29 3 Y 1 A MET -5 ? A MET 1 30 3 Y 1 A HIS -4 ? A HIS 2 31 3 Y 1 A HIS -3 ? A HIS 3 32 3 Y 1 A HIS -2 ? A HIS 4 33 3 Y 1 A HIS -1 ? A HIS 5 34 3 Y 1 A HIS 0 ? A HIS 6 35 3 Y 1 A HIS 1 ? A HIS 7 36 3 Y 1 B MET -5 ? B MET 1 37 3 Y 1 B HIS -4 ? B HIS 2 38 3 Y 1 B HIS -3 ? B HIS 3 39 3 Y 1 B HIS -2 ? B HIS 4 40 3 Y 1 B HIS -1 ? B HIS 5 41 3 Y 1 B HIS 0 ? B HIS 6 42 3 Y 1 B HIS 1 ? B HIS 7 43 4 Y 1 A MET -5 ? A MET 1 44 4 Y 1 A HIS -4 ? A HIS 2 45 4 Y 1 A HIS -3 ? A HIS 3 46 4 Y 1 A HIS -2 ? A HIS 4 47 4 Y 1 A HIS -1 ? A HIS 5 48 4 Y 1 A HIS 0 ? A HIS 6 49 4 Y 1 A HIS 1 ? A HIS 7 50 4 Y 1 B MET -5 ? B MET 1 51 4 Y 1 B HIS -4 ? B HIS 2 52 4 Y 1 B HIS -3 ? B HIS 3 53 4 Y 1 B HIS -2 ? B HIS 4 54 4 Y 1 B HIS -1 ? B HIS 5 55 4 Y 1 B HIS 0 ? B HIS 6 56 4 Y 1 B HIS 1 ? B HIS 7 57 5 Y 1 A MET -5 ? A MET 1 58 5 Y 1 A HIS -4 ? A HIS 2 59 5 Y 1 A HIS -3 ? A HIS 3 60 5 Y 1 A HIS -2 ? A HIS 4 61 5 Y 1 A HIS -1 ? A HIS 5 62 5 Y 1 A HIS 0 ? A HIS 6 63 5 Y 1 A HIS 1 ? A HIS 7 64 5 Y 1 B MET -5 ? B MET 1 65 5 Y 1 B HIS -4 ? B HIS 2 66 5 Y 1 B HIS -3 ? B HIS 3 67 5 Y 1 B HIS -2 ? B HIS 4 68 5 Y 1 B HIS -1 ? B HIS 5 69 5 Y 1 B HIS 0 ? B HIS 6 70 5 Y 1 B HIS 1 ? B HIS 7 71 6 Y 1 A MET -5 ? A MET 1 72 6 Y 1 A HIS -4 ? A HIS 2 73 6 Y 1 A HIS -3 ? A HIS 3 74 6 Y 1 A HIS -2 ? A HIS 4 75 6 Y 1 A HIS -1 ? A HIS 5 76 6 Y 1 A HIS 0 ? A HIS 6 77 6 Y 1 A HIS 1 ? A HIS 7 78 6 Y 1 B MET -5 ? B MET 1 79 6 Y 1 B HIS -4 ? B HIS 2 80 6 Y 1 B HIS -3 ? B HIS 3 81 6 Y 1 B HIS -2 ? B HIS 4 82 6 Y 1 B HIS -1 ? B HIS 5 83 6 Y 1 B HIS 0 ? B HIS 6 84 6 Y 1 B HIS 1 ? B HIS 7 85 7 Y 1 A MET -5 ? A MET 1 86 7 Y 1 A HIS -4 ? A HIS 2 87 7 Y 1 A HIS -3 ? A HIS 3 88 7 Y 1 A HIS -2 ? A HIS 4 89 7 Y 1 A HIS -1 ? A HIS 5 90 7 Y 1 A HIS 0 ? A HIS 6 91 7 Y 1 A HIS 1 ? A HIS 7 92 7 Y 1 B MET -5 ? B MET 1 93 7 Y 1 B HIS -4 ? B HIS 2 94 7 Y 1 B HIS -3 ? B HIS 3 95 7 Y 1 B HIS -2 ? B HIS 4 96 7 Y 1 B HIS -1 ? B HIS 5 97 7 Y 1 B HIS 0 ? B HIS 6 98 7 Y 1 B HIS 1 ? B HIS 7 99 8 Y 1 A MET -5 ? A MET 1 100 8 Y 1 A HIS -4 ? A HIS 2 101 8 Y 1 A HIS -3 ? A HIS 3 102 8 Y 1 A HIS -2 ? A HIS 4 103 8 Y 1 A HIS -1 ? A HIS 5 104 8 Y 1 A HIS 0 ? A HIS 6 105 8 Y 1 A HIS 1 ? A HIS 7 106 8 Y 1 B MET -5 ? B MET 1 107 8 Y 1 B HIS -4 ? B HIS 2 108 8 Y 1 B HIS -3 ? B HIS 3 109 8 Y 1 B HIS -2 ? B HIS 4 110 8 Y 1 B HIS -1 ? B HIS 5 111 8 Y 1 B HIS 0 ? B HIS 6 112 8 Y 1 B HIS 1 ? B HIS 7 113 9 Y 1 A MET -5 ? A MET 1 114 9 Y 1 A HIS -4 ? A HIS 2 115 9 Y 1 A HIS -3 ? A HIS 3 116 9 Y 1 A HIS -2 ? A HIS 4 117 9 Y 1 A HIS -1 ? A HIS 5 118 9 Y 1 A HIS 0 ? A HIS 6 119 9 Y 1 A HIS 1 ? A HIS 7 120 9 Y 1 B MET -5 ? B MET 1 121 9 Y 1 B HIS -4 ? B HIS 2 122 9 Y 1 B HIS -3 ? B HIS 3 123 9 Y 1 B HIS -2 ? B HIS 4 124 9 Y 1 B HIS -1 ? B HIS 5 125 9 Y 1 B HIS 0 ? B HIS 6 126 9 Y 1 B HIS 1 ? B HIS 7 127 10 Y 1 A MET -5 ? A MET 1 128 10 Y 1 A HIS -4 ? A HIS 2 129 10 Y 1 A HIS -3 ? A HIS 3 130 10 Y 1 A HIS -2 ? A HIS 4 131 10 Y 1 A HIS -1 ? A HIS 5 132 10 Y 1 A HIS 0 ? A HIS 6 133 10 Y 1 A HIS 1 ? A HIS 7 134 10 Y 1 B MET -5 ? B MET 1 135 10 Y 1 B HIS -4 ? B HIS 2 136 10 Y 1 B HIS -3 ? B HIS 3 137 10 Y 1 B HIS -2 ? B HIS 4 138 10 Y 1 B HIS -1 ? B HIS 5 139 10 Y 1 B HIS 0 ? B HIS 6 140 10 Y 1 B HIS 1 ? B HIS 7 141 11 Y 1 A MET -5 ? A MET 1 142 11 Y 1 A HIS -4 ? A HIS 2 143 11 Y 1 A HIS -3 ? A HIS 3 144 11 Y 1 A HIS -2 ? A HIS 4 145 11 Y 1 A HIS -1 ? A HIS 5 146 11 Y 1 A HIS 0 ? A HIS 6 147 11 Y 1 A HIS 1 ? A HIS 7 148 11 Y 1 B MET -5 ? B MET 1 149 11 Y 1 B HIS -4 ? B HIS 2 150 11 Y 1 B HIS -3 ? B HIS 3 151 11 Y 1 B HIS -2 ? B HIS 4 152 11 Y 1 B HIS -1 ? B HIS 5 153 11 Y 1 B HIS 0 ? B HIS 6 154 11 Y 1 B HIS 1 ? B HIS 7 155 12 Y 1 A MET -5 ? A MET 1 156 12 Y 1 A HIS -4 ? A HIS 2 157 12 Y 1 A HIS -3 ? A HIS 3 158 12 Y 1 A HIS -2 ? A HIS 4 159 12 Y 1 A HIS -1 ? A HIS 5 160 12 Y 1 A HIS 0 ? A HIS 6 161 12 Y 1 A HIS 1 ? A HIS 7 162 12 Y 1 B MET -5 ? B MET 1 163 12 Y 1 B HIS -4 ? B HIS 2 164 12 Y 1 B HIS -3 ? B HIS 3 165 12 Y 1 B HIS -2 ? B HIS 4 166 12 Y 1 B HIS -1 ? B HIS 5 167 12 Y 1 B HIS 0 ? B HIS 6 168 12 Y 1 B HIS 1 ? B HIS 7 169 13 Y 1 A MET -5 ? A MET 1 170 13 Y 1 A HIS -4 ? A HIS 2 171 13 Y 1 A HIS -3 ? A HIS 3 172 13 Y 1 A HIS -2 ? A HIS 4 173 13 Y 1 A HIS -1 ? A HIS 5 174 13 Y 1 A HIS 0 ? A HIS 6 175 13 Y 1 A HIS 1 ? A HIS 7 176 13 Y 1 B MET -5 ? B MET 1 177 13 Y 1 B HIS -4 ? B HIS 2 178 13 Y 1 B HIS -3 ? B HIS 3 179 13 Y 1 B HIS -2 ? B HIS 4 180 13 Y 1 B HIS -1 ? B HIS 5 181 13 Y 1 B HIS 0 ? B HIS 6 182 13 Y 1 B HIS 1 ? B HIS 7 183 14 Y 1 A MET -5 ? A MET 1 184 14 Y 1 A HIS -4 ? A HIS 2 185 14 Y 1 A HIS -3 ? A HIS 3 186 14 Y 1 A HIS -2 ? A HIS 4 187 14 Y 1 A HIS -1 ? A HIS 5 188 14 Y 1 A HIS 0 ? A HIS 6 189 14 Y 1 A HIS 1 ? A HIS 7 190 14 Y 1 B MET -5 ? B MET 1 191 14 Y 1 B HIS -4 ? B HIS 2 192 14 Y 1 B HIS -3 ? B HIS 3 193 14 Y 1 B HIS -2 ? B HIS 4 194 14 Y 1 B HIS -1 ? B HIS 5 195 14 Y 1 B HIS 0 ? B HIS 6 196 14 Y 1 B HIS 1 ? B HIS 7 197 15 Y 1 A MET -5 ? A MET 1 198 15 Y 1 A HIS -4 ? A HIS 2 199 15 Y 1 A HIS -3 ? A HIS 3 200 15 Y 1 A HIS -2 ? A HIS 4 201 15 Y 1 A HIS -1 ? A HIS 5 202 15 Y 1 A HIS 0 ? A HIS 6 203 15 Y 1 A HIS 1 ? A HIS 7 204 15 Y 1 B MET -5 ? B MET 1 205 15 Y 1 B HIS -4 ? B HIS 2 206 15 Y 1 B HIS -3 ? B HIS 3 207 15 Y 1 B HIS -2 ? B HIS 4 208 15 Y 1 B HIS -1 ? B HIS 5 209 15 Y 1 B HIS 0 ? B HIS 6 210 15 Y 1 B HIS 1 ? B HIS 7 211 16 Y 1 A MET -5 ? A MET 1 212 16 Y 1 A HIS -4 ? A HIS 2 213 16 Y 1 A HIS -3 ? A HIS 3 214 16 Y 1 A HIS -2 ? A HIS 4 215 16 Y 1 A HIS -1 ? A HIS 5 216 16 Y 1 A HIS 0 ? A HIS 6 217 16 Y 1 A HIS 1 ? A HIS 7 218 16 Y 1 B MET -5 ? B MET 1 219 16 Y 1 B HIS -4 ? B HIS 2 220 16 Y 1 B HIS -3 ? B HIS 3 221 16 Y 1 B HIS -2 ? B HIS 4 222 16 Y 1 B HIS -1 ? B HIS 5 223 16 Y 1 B HIS 0 ? B HIS 6 224 16 Y 1 B HIS 1 ? B HIS 7 225 17 Y 1 A MET -5 ? A MET 1 226 17 Y 1 A HIS -4 ? A HIS 2 227 17 Y 1 A HIS -3 ? A HIS 3 228 17 Y 1 A HIS -2 ? A HIS 4 229 17 Y 1 A HIS -1 ? A HIS 5 230 17 Y 1 A HIS 0 ? A HIS 6 231 17 Y 1 A HIS 1 ? A HIS 7 232 17 Y 1 B MET -5 ? B MET 1 233 17 Y 1 B HIS -4 ? B HIS 2 234 17 Y 1 B HIS -3 ? B HIS 3 235 17 Y 1 B HIS -2 ? B HIS 4 236 17 Y 1 B HIS -1 ? B HIS 5 237 17 Y 1 B HIS 0 ? B HIS 6 238 17 Y 1 B HIS 1 ? B HIS 7 239 18 Y 1 A MET -5 ? A MET 1 240 18 Y 1 A HIS -4 ? A HIS 2 241 18 Y 1 A HIS -3 ? A HIS 3 242 18 Y 1 A HIS -2 ? A HIS 4 243 18 Y 1 A HIS -1 ? A HIS 5 244 18 Y 1 A HIS 0 ? A HIS 6 245 18 Y 1 A HIS 1 ? A HIS 7 246 18 Y 1 B MET -5 ? B MET 1 247 18 Y 1 B HIS -4 ? B HIS 2 248 18 Y 1 B HIS -3 ? B HIS 3 249 18 Y 1 B HIS -2 ? B HIS 4 250 18 Y 1 B HIS -1 ? B HIS 5 251 18 Y 1 B HIS 0 ? B HIS 6 252 18 Y 1 B HIS 1 ? B HIS 7 253 19 Y 1 A MET -5 ? A MET 1 254 19 Y 1 A HIS -4 ? A HIS 2 255 19 Y 1 A HIS -3 ? A HIS 3 256 19 Y 1 A HIS -2 ? A HIS 4 257 19 Y 1 A HIS -1 ? A HIS 5 258 19 Y 1 A HIS 0 ? A HIS 6 259 19 Y 1 A HIS 1 ? A HIS 7 260 19 Y 1 B MET -5 ? B MET 1 261 19 Y 1 B HIS -4 ? B HIS 2 262 19 Y 1 B HIS -3 ? B HIS 3 263 19 Y 1 B HIS -2 ? B HIS 4 264 19 Y 1 B HIS -1 ? B HIS 5 265 19 Y 1 B HIS 0 ? B HIS 6 266 19 Y 1 B HIS 1 ? B HIS 7 267 20 Y 1 A MET -5 ? A MET 1 268 20 Y 1 A HIS -4 ? A HIS 2 269 20 Y 1 A HIS -3 ? A HIS 3 270 20 Y 1 A HIS -2 ? A HIS 4 271 20 Y 1 A HIS -1 ? A HIS 5 272 20 Y 1 A HIS 0 ? A HIS 6 273 20 Y 1 A HIS 1 ? A HIS 7 274 20 Y 1 B MET -5 ? B MET 1 275 20 Y 1 B HIS -4 ? B HIS 2 276 20 Y 1 B HIS -3 ? B HIS 3 277 20 Y 1 B HIS -2 ? B HIS 4 278 20 Y 1 B HIS -1 ? B HIS 5 279 20 Y 1 B HIS 0 ? B HIS 6 280 20 Y 1 B HIS 1 ? B HIS 7 281 21 Y 1 A MET -5 ? A MET 1 282 21 Y 1 A HIS -4 ? A HIS 2 283 21 Y 1 A HIS -3 ? A HIS 3 284 21 Y 1 A HIS -2 ? A HIS 4 285 21 Y 1 A HIS -1 ? A HIS 5 286 21 Y 1 A HIS 0 ? A HIS 6 287 21 Y 1 A HIS 1 ? A HIS 7 288 21 Y 1 B MET -5 ? B MET 1 289 21 Y 1 B HIS -4 ? B HIS 2 290 21 Y 1 B HIS -3 ? B HIS 3 291 21 Y 1 B HIS -2 ? B HIS 4 292 21 Y 1 B HIS -1 ? B HIS 5 293 21 Y 1 B HIS 0 ? B HIS 6 294 21 Y 1 B HIS 1 ? B HIS 7 295 22 Y 1 A MET -5 ? A MET 1 296 22 Y 1 A HIS -4 ? A HIS 2 297 22 Y 1 A HIS -3 ? A HIS 3 298 22 Y 1 A HIS -2 ? A HIS 4 299 22 Y 1 A HIS -1 ? A HIS 5 300 22 Y 1 A HIS 0 ? A HIS 6 301 22 Y 1 A HIS 1 ? A HIS 7 302 22 Y 1 B MET -5 ? B MET 1 303 22 Y 1 B HIS -4 ? B HIS 2 304 22 Y 1 B HIS -3 ? B HIS 3 305 22 Y 1 B HIS -2 ? B HIS 4 306 22 Y 1 B HIS -1 ? B HIS 5 307 22 Y 1 B HIS 0 ? B HIS 6 308 22 Y 1 B HIS 1 ? B HIS 7 #