data_1YSM # _entry.id 1YSM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YSM pdb_00001ysm 10.2210/pdb1ysm/pdb RCSB RCSB031884 ? ? WWPDB D_1000031884 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YSM _pdbx_database_status.recvd_initial_deposition_date 2005-02-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bhattacharya, S.' 1 'Lee, Y.T.' 2 'Michowski, W.' 3 'Jastrzebska, B.' 4 'Filipek, A.' 5 'Kuznicki, J.' 6 'Chazin, W.J.' 7 # _citation.id primary _citation.title 'The Modular Structure of SIP Facilitates Its Role in Stabilizing Multiprotein Assemblies.' _citation.journal_abbrev Biochemistry _citation.journal_volume 44 _citation.page_first 9462 _citation.page_last 9471 _citation.year 2005 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15996101 _citation.pdbx_database_id_DOI 10.1021/bi0502689 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bhattacharya, S.' 1 ? primary 'Lee, Y.T.' 2 ? primary 'Michowski, W.' 3 ? primary 'Jastrzebska, B.' 4 ? primary 'Filipek, A.' 5 ? primary 'Kuznicki, J.' 6 ? primary 'Chazin, W.J.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Calcyclin-binding protein' _entity.formula_weight 8787.200 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-Terminal Domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CacyBP, Siah-interacting protein, SIP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MASVLEELQKDLEEVKVLLEKSTRKRLRDTLTSEKSKIETELKNKMQQKSQKKPELDNEKPAAVVAPLTTGYTVKIS _entity_poly.pdbx_seq_one_letter_code_can MASVLEELQKDLEEVKVLLEKSTRKRLRDTLTSEKSKIETELKNKMQQKSQKKPELDNEKPAAVVAPLTTGYTVKIS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 VAL n 1 5 LEU n 1 6 GLU n 1 7 GLU n 1 8 LEU n 1 9 GLN n 1 10 LYS n 1 11 ASP n 1 12 LEU n 1 13 GLU n 1 14 GLU n 1 15 VAL n 1 16 LYS n 1 17 VAL n 1 18 LEU n 1 19 LEU n 1 20 GLU n 1 21 LYS n 1 22 SER n 1 23 THR n 1 24 ARG n 1 25 LYS n 1 26 ARG n 1 27 LEU n 1 28 ARG n 1 29 ASP n 1 30 THR n 1 31 LEU n 1 32 THR n 1 33 SER n 1 34 GLU n 1 35 LYS n 1 36 SER n 1 37 LYS n 1 38 ILE n 1 39 GLU n 1 40 THR n 1 41 GLU n 1 42 LEU n 1 43 LYS n 1 44 ASN n 1 45 LYS n 1 46 MET n 1 47 GLN n 1 48 GLN n 1 49 LYS n 1 50 SER n 1 51 GLN n 1 52 LYS n 1 53 LYS n 1 54 PRO n 1 55 GLU n 1 56 LEU n 1 57 ASP n 1 58 ASN n 1 59 GLU n 1 60 LYS n 1 61 PRO n 1 62 ALA n 1 63 ALA n 1 64 VAL n 1 65 VAL n 1 66 ALA n 1 67 PRO n 1 68 LEU n 1 69 THR n 1 70 THR n 1 71 GLY n 1 72 TYR n 1 73 THR n 1 74 VAL n 1 75 LYS n 1 76 ILE n 1 77 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'Cacybp, Sip' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYBP_MOUSE _struct_ref.pdbx_db_accession Q9CXW3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MASVLEELQKDLEEVKVLLEKSTRKRLRDTLTSEKSKIETELKNKMQQKSQKKPELDNEKPAAVVAPLTTGYTVKIS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YSM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9CXW3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 2 2 1 3D_13C-separated_NOESY 4 3 1 4D_13C/15N-separated_NOESY 1 4 1 4D_13C-separated_NOESY 4 5 1 HNHA 2 6 1 HNHB 2 7 1 3D-HACAHB-COSY 4 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM NaPi, 50 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM 15N/13C-enriched SIP(1-77), 20 mM NaPi, 50 mM NaCl' '90% H2O/10% D2O' 2 '1 mM 15N-enriched SIP(1-77), 20 mM NaPi, 50 mM NaCl' '90% H2O/10% D2O' 3 '1 mM U-SIP(1-77), 20 mM NaPi, 50 mM NaCl' '90% H2O/10% D2O' 4 '1 mM 13C-enriched SIP(1-77), 20 mM NaPi, 50 mM NaCl' '100% D2O' 5 '1 mM 10% 13C-enriched SIP(1-77), 20 mM NaPi, 50 mM NaCl' '100% D2O' 6 '1 mM U-SIP(1-77), 20 mM NaPi, 50 mM NaCl' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 600 ? 2 AVANCE Bruker 800 ? # _pdbx_nmr_refine.entry_id 1YSM _pdbx_nmr_refine.method ;Torsion Angle Dynamics Simulated Annealing Restrained Molecular Dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1YSM _pdbx_nmr_details.text 'Stereospecific methyl group assignments were made with 10% 13C-enriched SIP(1-77) sample.' # _pdbx_nmr_ensemble.entry_id 1YSM _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with favorable non-bond energy, least restraint violations and lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1YSM _pdbx_nmr_representative.conformer_id 2 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.0 Bruker 1 processing Felix 2000 Accelrys 2 'data analysis' SANE 1.0 'Duggan, B. M.' 3 'structure solution' DYANA 1.5 'Guntert, P.' 4 refinement Amber 7.0 'Pearlman, D. A.' 5 # _exptl.entry_id 1YSM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1YSM _struct.title 'NMR Structure of N-terminal domain (Residues 1-77) of Siah-Interacting Protein.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YSM _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'helix-turn-helix, Metal Binding Protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 1 ? SER A 22 ? MET A 1 SER A 22 1 ? 22 HELX_P HELX_P2 2 ARG A 26 ? GLN A 48 ? ARG A 26 GLN A 48 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1YSM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1YSM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LEU 56 56 ? ? ? A . n A 1 57 ASP 57 57 ? ? ? A . n A 1 58 ASN 58 58 ? ? ? A . n A 1 59 GLU 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 PRO 61 61 ? ? ? A . n A 1 62 ALA 62 62 ? ? ? A . n A 1 63 ALA 63 63 ? ? ? A . n A 1 64 VAL 64 64 ? ? ? A . n A 1 65 VAL 65 65 ? ? ? A . n A 1 66 ALA 66 66 ? ? ? A . n A 1 67 PRO 67 67 ? ? ? A . n A 1 68 LEU 68 68 ? ? ? A . n A 1 69 THR 69 69 ? ? ? A . n A 1 70 THR 70 70 ? ? ? A . n A 1 71 GLY 71 71 ? ? ? A . n A 1 72 TYR 72 72 ? ? ? A . n A 1 73 THR 73 73 ? ? ? A . n A 1 74 VAL 74 74 ? ? ? A . n A 1 75 LYS 75 75 ? ? ? A . n A 1 76 ILE 76 76 ? ? ? A . n A 1 77 SER 77 77 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-07-26 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 18 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 26 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 26 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 26 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.00 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.30 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 25 ? ? 63.10 -37.37 2 1 ARG A 26 ? ? -33.66 -38.11 3 1 LYS A 49 ? ? -84.13 -83.78 4 1 SER A 50 ? ? 43.16 28.80 5 2 THR A 23 ? ? -65.72 12.06 6 2 LYS A 25 ? ? 70.70 -43.54 7 2 GLN A 47 ? ? -160.11 64.91 8 3 THR A 23 ? ? -65.57 37.89 9 3 LYS A 49 ? ? 86.44 -130.47 10 3 GLN A 51 ? ? 63.02 -71.89 11 3 LYS A 52 ? ? 60.23 -69.67 12 4 LYS A 21 ? ? -73.63 -70.71 13 4 THR A 23 ? ? -73.01 42.77 14 5 THR A 23 ? ? -72.43 45.16 15 5 GLN A 48 ? ? 59.14 -69.81 16 5 SER A 50 ? ? -76.18 47.86 17 6 SER A 22 ? ? -82.89 48.44 18 6 THR A 23 ? ? -71.66 26.87 19 6 LYS A 25 ? ? -172.02 -40.12 20 6 MET A 46 ? ? -69.94 -72.69 21 6 SER A 50 ? ? 66.56 -37.99 22 7 THR A 23 ? ? -68.55 42.80 23 7 MET A 46 ? ? -63.01 -70.46 24 7 GLN A 48 ? ? 67.76 -34.10 25 8 THR A 23 ? ? -67.39 38.44 26 8 MET A 46 ? ? -91.03 -70.96 27 8 SER A 50 ? ? 60.03 -80.88 28 8 LYS A 53 ? ? 62.70 83.43 29 9 THR A 23 ? ? -72.61 38.93 30 9 SER A 50 ? ? -76.60 45.80 31 10 SER A 22 ? ? -74.90 47.51 32 10 LYS A 25 ? ? 73.15 -48.39 33 10 ARG A 26 ? ? -57.90 -7.84 34 10 GLN A 48 ? ? 55.96 -80.26 35 10 LYS A 49 ? ? 64.19 -57.92 36 10 LYS A 52 ? ? -76.82 45.67 37 10 LYS A 53 ? ? 177.12 146.45 38 11 THR A 23 ? ? 71.66 -55.03 39 11 LYS A 25 ? ? 73.50 -35.08 40 11 GLN A 48 ? ? -75.07 41.10 41 11 GLN A 51 ? ? -145.09 -51.37 42 12 LYS A 21 ? ? -79.64 -72.59 43 12 THR A 23 ? ? -76.59 38.21 44 12 GLN A 51 ? ? 72.77 -45.33 45 12 LYS A 52 ? ? -122.60 -68.10 46 13 THR A 23 ? ? 70.18 -32.22 47 13 ARG A 24 ? ? -44.11 150.17 48 13 LYS A 25 ? ? -60.78 4.54 49 13 GLN A 48 ? ? -57.03 105.20 50 13 LYS A 52 ? ? -67.67 79.34 51 13 PRO A 54 ? ? -65.99 92.53 52 14 LYS A 25 ? ? 64.54 -34.96 53 14 ARG A 26 ? ? -36.44 -39.10 54 14 MET A 46 ? ? -90.73 -68.10 55 14 SER A 50 ? ? 157.08 -173.00 56 15 THR A 23 ? ? 66.05 -28.03 57 15 ARG A 24 ? ? -65.94 -175.76 58 15 GLN A 47 ? ? -163.69 48.09 59 15 LYS A 49 ? ? -64.37 77.86 60 15 GLN A 51 ? ? 68.91 -52.96 61 16 THR A 23 ? ? -47.51 -19.50 62 16 LYS A 25 ? ? 71.09 -44.21 63 16 LYS A 49 ? ? 68.01 -65.14 64 16 PRO A 54 ? ? -62.63 66.44 65 17 LYS A 49 ? ? -147.93 -54.47 66 18 THR A 23 ? ? -74.85 40.58 67 18 GLN A 48 ? ? 69.61 -71.29 68 19 THR A 23 ? ? 68.42 -52.17 69 19 LYS A 25 ? ? -60.91 15.04 70 19 GLN A 47 ? ? -142.38 10.40 71 19 GLN A 48 ? ? 54.88 -87.04 72 19 GLN A 51 ? ? 34.19 -68.47 73 20 THR A 23 ? ? -73.43 28.76 74 20 ARG A 26 ? ? -37.73 -38.68 75 20 GLN A 48 ? ? 48.74 -136.67 76 20 GLN A 51 ? ? 37.09 39.10 77 20 LYS A 52 ? ? 70.96 -68.92 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 26 ? ? 0.077 'SIDE CHAIN' 2 2 ARG A 24 ? ? 0.099 'SIDE CHAIN' 3 5 ARG A 26 ? ? 0.108 'SIDE CHAIN' 4 6 ARG A 24 ? ? 0.127 'SIDE CHAIN' 5 8 ARG A 28 ? ? 0.084 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 56 ? A LEU 56 2 1 Y 1 A ASP 57 ? A ASP 57 3 1 Y 1 A ASN 58 ? A ASN 58 4 1 Y 1 A GLU 59 ? A GLU 59 5 1 Y 1 A LYS 60 ? A LYS 60 6 1 Y 1 A PRO 61 ? A PRO 61 7 1 Y 1 A ALA 62 ? A ALA 62 8 1 Y 1 A ALA 63 ? A ALA 63 9 1 Y 1 A VAL 64 ? A VAL 64 10 1 Y 1 A VAL 65 ? A VAL 65 11 1 Y 1 A ALA 66 ? A ALA 66 12 1 Y 1 A PRO 67 ? A PRO 67 13 1 Y 1 A LEU 68 ? A LEU 68 14 1 Y 1 A THR 69 ? A THR 69 15 1 Y 1 A THR 70 ? A THR 70 16 1 Y 1 A GLY 71 ? A GLY 71 17 1 Y 1 A TYR 72 ? A TYR 72 18 1 Y 1 A THR 73 ? A THR 73 19 1 Y 1 A VAL 74 ? A VAL 74 20 1 Y 1 A LYS 75 ? A LYS 75 21 1 Y 1 A ILE 76 ? A ILE 76 22 1 Y 1 A SER 77 ? A SER 77 23 2 Y 1 A LEU 56 ? A LEU 56 24 2 Y 1 A ASP 57 ? A ASP 57 25 2 Y 1 A ASN 58 ? A ASN 58 26 2 Y 1 A GLU 59 ? A GLU 59 27 2 Y 1 A LYS 60 ? A LYS 60 28 2 Y 1 A PRO 61 ? A PRO 61 29 2 Y 1 A ALA 62 ? A ALA 62 30 2 Y 1 A ALA 63 ? A ALA 63 31 2 Y 1 A VAL 64 ? A VAL 64 32 2 Y 1 A VAL 65 ? A VAL 65 33 2 Y 1 A ALA 66 ? A ALA 66 34 2 Y 1 A PRO 67 ? A PRO 67 35 2 Y 1 A LEU 68 ? A LEU 68 36 2 Y 1 A THR 69 ? A THR 69 37 2 Y 1 A THR 70 ? A THR 70 38 2 Y 1 A GLY 71 ? A GLY 71 39 2 Y 1 A TYR 72 ? A TYR 72 40 2 Y 1 A THR 73 ? A THR 73 41 2 Y 1 A VAL 74 ? A VAL 74 42 2 Y 1 A LYS 75 ? A LYS 75 43 2 Y 1 A ILE 76 ? A ILE 76 44 2 Y 1 A SER 77 ? A SER 77 45 3 Y 1 A LEU 56 ? A LEU 56 46 3 Y 1 A ASP 57 ? A ASP 57 47 3 Y 1 A ASN 58 ? A ASN 58 48 3 Y 1 A GLU 59 ? A GLU 59 49 3 Y 1 A LYS 60 ? A LYS 60 50 3 Y 1 A PRO 61 ? A PRO 61 51 3 Y 1 A ALA 62 ? A ALA 62 52 3 Y 1 A ALA 63 ? A ALA 63 53 3 Y 1 A VAL 64 ? A VAL 64 54 3 Y 1 A VAL 65 ? A VAL 65 55 3 Y 1 A ALA 66 ? A ALA 66 56 3 Y 1 A PRO 67 ? A PRO 67 57 3 Y 1 A LEU 68 ? A LEU 68 58 3 Y 1 A THR 69 ? A THR 69 59 3 Y 1 A THR 70 ? A THR 70 60 3 Y 1 A GLY 71 ? A GLY 71 61 3 Y 1 A TYR 72 ? A TYR 72 62 3 Y 1 A THR 73 ? A THR 73 63 3 Y 1 A VAL 74 ? A VAL 74 64 3 Y 1 A LYS 75 ? A LYS 75 65 3 Y 1 A ILE 76 ? A ILE 76 66 3 Y 1 A SER 77 ? A SER 77 67 4 Y 1 A LEU 56 ? A LEU 56 68 4 Y 1 A ASP 57 ? A ASP 57 69 4 Y 1 A ASN 58 ? A ASN 58 70 4 Y 1 A GLU 59 ? A GLU 59 71 4 Y 1 A LYS 60 ? A LYS 60 72 4 Y 1 A PRO 61 ? A PRO 61 73 4 Y 1 A ALA 62 ? A ALA 62 74 4 Y 1 A ALA 63 ? A ALA 63 75 4 Y 1 A VAL 64 ? A VAL 64 76 4 Y 1 A VAL 65 ? A VAL 65 77 4 Y 1 A ALA 66 ? A ALA 66 78 4 Y 1 A PRO 67 ? A PRO 67 79 4 Y 1 A LEU 68 ? A LEU 68 80 4 Y 1 A THR 69 ? A THR 69 81 4 Y 1 A THR 70 ? A THR 70 82 4 Y 1 A GLY 71 ? A GLY 71 83 4 Y 1 A TYR 72 ? A TYR 72 84 4 Y 1 A THR 73 ? A THR 73 85 4 Y 1 A VAL 74 ? A VAL 74 86 4 Y 1 A LYS 75 ? A LYS 75 87 4 Y 1 A ILE 76 ? A ILE 76 88 4 Y 1 A SER 77 ? A SER 77 89 5 Y 1 A LEU 56 ? A LEU 56 90 5 Y 1 A ASP 57 ? A ASP 57 91 5 Y 1 A ASN 58 ? A ASN 58 92 5 Y 1 A GLU 59 ? A GLU 59 93 5 Y 1 A LYS 60 ? A LYS 60 94 5 Y 1 A PRO 61 ? A PRO 61 95 5 Y 1 A ALA 62 ? A ALA 62 96 5 Y 1 A ALA 63 ? A ALA 63 97 5 Y 1 A VAL 64 ? A VAL 64 98 5 Y 1 A VAL 65 ? A VAL 65 99 5 Y 1 A ALA 66 ? A ALA 66 100 5 Y 1 A PRO 67 ? A PRO 67 101 5 Y 1 A LEU 68 ? A LEU 68 102 5 Y 1 A THR 69 ? A THR 69 103 5 Y 1 A THR 70 ? A THR 70 104 5 Y 1 A GLY 71 ? A GLY 71 105 5 Y 1 A TYR 72 ? A TYR 72 106 5 Y 1 A THR 73 ? A THR 73 107 5 Y 1 A VAL 74 ? A VAL 74 108 5 Y 1 A LYS 75 ? A LYS 75 109 5 Y 1 A ILE 76 ? A ILE 76 110 5 Y 1 A SER 77 ? A SER 77 111 6 Y 1 A LEU 56 ? A LEU 56 112 6 Y 1 A ASP 57 ? A ASP 57 113 6 Y 1 A ASN 58 ? A ASN 58 114 6 Y 1 A GLU 59 ? A GLU 59 115 6 Y 1 A LYS 60 ? A LYS 60 116 6 Y 1 A PRO 61 ? A PRO 61 117 6 Y 1 A ALA 62 ? A ALA 62 118 6 Y 1 A ALA 63 ? A ALA 63 119 6 Y 1 A VAL 64 ? A VAL 64 120 6 Y 1 A VAL 65 ? A VAL 65 121 6 Y 1 A ALA 66 ? A ALA 66 122 6 Y 1 A PRO 67 ? A PRO 67 123 6 Y 1 A LEU 68 ? A LEU 68 124 6 Y 1 A THR 69 ? A THR 69 125 6 Y 1 A THR 70 ? A THR 70 126 6 Y 1 A GLY 71 ? A GLY 71 127 6 Y 1 A TYR 72 ? A TYR 72 128 6 Y 1 A THR 73 ? A THR 73 129 6 Y 1 A VAL 74 ? A VAL 74 130 6 Y 1 A LYS 75 ? A LYS 75 131 6 Y 1 A ILE 76 ? A ILE 76 132 6 Y 1 A SER 77 ? A SER 77 133 7 Y 1 A LEU 56 ? A LEU 56 134 7 Y 1 A ASP 57 ? A ASP 57 135 7 Y 1 A ASN 58 ? A ASN 58 136 7 Y 1 A GLU 59 ? A GLU 59 137 7 Y 1 A LYS 60 ? A LYS 60 138 7 Y 1 A PRO 61 ? A PRO 61 139 7 Y 1 A ALA 62 ? A ALA 62 140 7 Y 1 A ALA 63 ? A ALA 63 141 7 Y 1 A VAL 64 ? A VAL 64 142 7 Y 1 A VAL 65 ? A VAL 65 143 7 Y 1 A ALA 66 ? A ALA 66 144 7 Y 1 A PRO 67 ? A PRO 67 145 7 Y 1 A LEU 68 ? A LEU 68 146 7 Y 1 A THR 69 ? A THR 69 147 7 Y 1 A THR 70 ? A THR 70 148 7 Y 1 A GLY 71 ? A GLY 71 149 7 Y 1 A TYR 72 ? A TYR 72 150 7 Y 1 A THR 73 ? A THR 73 151 7 Y 1 A VAL 74 ? A VAL 74 152 7 Y 1 A LYS 75 ? A LYS 75 153 7 Y 1 A ILE 76 ? A ILE 76 154 7 Y 1 A SER 77 ? A SER 77 155 8 Y 1 A LEU 56 ? A LEU 56 156 8 Y 1 A ASP 57 ? A ASP 57 157 8 Y 1 A ASN 58 ? A ASN 58 158 8 Y 1 A GLU 59 ? A GLU 59 159 8 Y 1 A LYS 60 ? A LYS 60 160 8 Y 1 A PRO 61 ? A PRO 61 161 8 Y 1 A ALA 62 ? A ALA 62 162 8 Y 1 A ALA 63 ? A ALA 63 163 8 Y 1 A VAL 64 ? A VAL 64 164 8 Y 1 A VAL 65 ? A VAL 65 165 8 Y 1 A ALA 66 ? A ALA 66 166 8 Y 1 A PRO 67 ? A PRO 67 167 8 Y 1 A LEU 68 ? A LEU 68 168 8 Y 1 A THR 69 ? A THR 69 169 8 Y 1 A THR 70 ? A THR 70 170 8 Y 1 A GLY 71 ? A GLY 71 171 8 Y 1 A TYR 72 ? A TYR 72 172 8 Y 1 A THR 73 ? A THR 73 173 8 Y 1 A VAL 74 ? A VAL 74 174 8 Y 1 A LYS 75 ? A LYS 75 175 8 Y 1 A ILE 76 ? A ILE 76 176 8 Y 1 A SER 77 ? A SER 77 177 9 Y 1 A LEU 56 ? A LEU 56 178 9 Y 1 A ASP 57 ? A ASP 57 179 9 Y 1 A ASN 58 ? A ASN 58 180 9 Y 1 A GLU 59 ? A GLU 59 181 9 Y 1 A LYS 60 ? A LYS 60 182 9 Y 1 A PRO 61 ? A PRO 61 183 9 Y 1 A ALA 62 ? A ALA 62 184 9 Y 1 A ALA 63 ? A ALA 63 185 9 Y 1 A VAL 64 ? A VAL 64 186 9 Y 1 A VAL 65 ? A VAL 65 187 9 Y 1 A ALA 66 ? A ALA 66 188 9 Y 1 A PRO 67 ? A PRO 67 189 9 Y 1 A LEU 68 ? A LEU 68 190 9 Y 1 A THR 69 ? A THR 69 191 9 Y 1 A THR 70 ? A THR 70 192 9 Y 1 A GLY 71 ? A GLY 71 193 9 Y 1 A TYR 72 ? A TYR 72 194 9 Y 1 A THR 73 ? A THR 73 195 9 Y 1 A VAL 74 ? A VAL 74 196 9 Y 1 A LYS 75 ? A LYS 75 197 9 Y 1 A ILE 76 ? A ILE 76 198 9 Y 1 A SER 77 ? A SER 77 199 10 Y 1 A LEU 56 ? A LEU 56 200 10 Y 1 A ASP 57 ? A ASP 57 201 10 Y 1 A ASN 58 ? A ASN 58 202 10 Y 1 A GLU 59 ? A GLU 59 203 10 Y 1 A LYS 60 ? A LYS 60 204 10 Y 1 A PRO 61 ? A PRO 61 205 10 Y 1 A ALA 62 ? A ALA 62 206 10 Y 1 A ALA 63 ? A ALA 63 207 10 Y 1 A VAL 64 ? A VAL 64 208 10 Y 1 A VAL 65 ? A VAL 65 209 10 Y 1 A ALA 66 ? A ALA 66 210 10 Y 1 A PRO 67 ? A PRO 67 211 10 Y 1 A LEU 68 ? A LEU 68 212 10 Y 1 A THR 69 ? A THR 69 213 10 Y 1 A THR 70 ? A THR 70 214 10 Y 1 A GLY 71 ? A GLY 71 215 10 Y 1 A TYR 72 ? A TYR 72 216 10 Y 1 A THR 73 ? A THR 73 217 10 Y 1 A VAL 74 ? A VAL 74 218 10 Y 1 A LYS 75 ? A LYS 75 219 10 Y 1 A ILE 76 ? A ILE 76 220 10 Y 1 A SER 77 ? A SER 77 221 11 Y 1 A LEU 56 ? A LEU 56 222 11 Y 1 A ASP 57 ? A ASP 57 223 11 Y 1 A ASN 58 ? A ASN 58 224 11 Y 1 A GLU 59 ? A GLU 59 225 11 Y 1 A LYS 60 ? A LYS 60 226 11 Y 1 A PRO 61 ? A PRO 61 227 11 Y 1 A ALA 62 ? A ALA 62 228 11 Y 1 A ALA 63 ? A ALA 63 229 11 Y 1 A VAL 64 ? A VAL 64 230 11 Y 1 A VAL 65 ? A VAL 65 231 11 Y 1 A ALA 66 ? A ALA 66 232 11 Y 1 A PRO 67 ? A PRO 67 233 11 Y 1 A LEU 68 ? A LEU 68 234 11 Y 1 A THR 69 ? A THR 69 235 11 Y 1 A THR 70 ? A THR 70 236 11 Y 1 A GLY 71 ? A GLY 71 237 11 Y 1 A TYR 72 ? A TYR 72 238 11 Y 1 A THR 73 ? A THR 73 239 11 Y 1 A VAL 74 ? A VAL 74 240 11 Y 1 A LYS 75 ? A LYS 75 241 11 Y 1 A ILE 76 ? A ILE 76 242 11 Y 1 A SER 77 ? A SER 77 243 12 Y 1 A LEU 56 ? A LEU 56 244 12 Y 1 A ASP 57 ? A ASP 57 245 12 Y 1 A ASN 58 ? A ASN 58 246 12 Y 1 A GLU 59 ? A GLU 59 247 12 Y 1 A LYS 60 ? A LYS 60 248 12 Y 1 A PRO 61 ? A PRO 61 249 12 Y 1 A ALA 62 ? A ALA 62 250 12 Y 1 A ALA 63 ? A ALA 63 251 12 Y 1 A VAL 64 ? A VAL 64 252 12 Y 1 A VAL 65 ? A VAL 65 253 12 Y 1 A ALA 66 ? A ALA 66 254 12 Y 1 A PRO 67 ? A PRO 67 255 12 Y 1 A LEU 68 ? A LEU 68 256 12 Y 1 A THR 69 ? A THR 69 257 12 Y 1 A THR 70 ? A THR 70 258 12 Y 1 A GLY 71 ? A GLY 71 259 12 Y 1 A TYR 72 ? A TYR 72 260 12 Y 1 A THR 73 ? A THR 73 261 12 Y 1 A VAL 74 ? A VAL 74 262 12 Y 1 A LYS 75 ? A LYS 75 263 12 Y 1 A ILE 76 ? A ILE 76 264 12 Y 1 A SER 77 ? A SER 77 265 13 Y 1 A LEU 56 ? A LEU 56 266 13 Y 1 A ASP 57 ? A ASP 57 267 13 Y 1 A ASN 58 ? A ASN 58 268 13 Y 1 A GLU 59 ? A GLU 59 269 13 Y 1 A LYS 60 ? A LYS 60 270 13 Y 1 A PRO 61 ? A PRO 61 271 13 Y 1 A ALA 62 ? A ALA 62 272 13 Y 1 A ALA 63 ? A ALA 63 273 13 Y 1 A VAL 64 ? A VAL 64 274 13 Y 1 A VAL 65 ? A VAL 65 275 13 Y 1 A ALA 66 ? A ALA 66 276 13 Y 1 A PRO 67 ? A PRO 67 277 13 Y 1 A LEU 68 ? A LEU 68 278 13 Y 1 A THR 69 ? A THR 69 279 13 Y 1 A THR 70 ? A THR 70 280 13 Y 1 A GLY 71 ? A GLY 71 281 13 Y 1 A TYR 72 ? A TYR 72 282 13 Y 1 A THR 73 ? A THR 73 283 13 Y 1 A VAL 74 ? A VAL 74 284 13 Y 1 A LYS 75 ? A LYS 75 285 13 Y 1 A ILE 76 ? A ILE 76 286 13 Y 1 A SER 77 ? A SER 77 287 14 Y 1 A LEU 56 ? A LEU 56 288 14 Y 1 A ASP 57 ? A ASP 57 289 14 Y 1 A ASN 58 ? A ASN 58 290 14 Y 1 A GLU 59 ? A GLU 59 291 14 Y 1 A LYS 60 ? A LYS 60 292 14 Y 1 A PRO 61 ? A PRO 61 293 14 Y 1 A ALA 62 ? A ALA 62 294 14 Y 1 A ALA 63 ? A ALA 63 295 14 Y 1 A VAL 64 ? A VAL 64 296 14 Y 1 A VAL 65 ? A VAL 65 297 14 Y 1 A ALA 66 ? A ALA 66 298 14 Y 1 A PRO 67 ? A PRO 67 299 14 Y 1 A LEU 68 ? A LEU 68 300 14 Y 1 A THR 69 ? A THR 69 301 14 Y 1 A THR 70 ? A THR 70 302 14 Y 1 A GLY 71 ? A GLY 71 303 14 Y 1 A TYR 72 ? A TYR 72 304 14 Y 1 A THR 73 ? A THR 73 305 14 Y 1 A VAL 74 ? A VAL 74 306 14 Y 1 A LYS 75 ? A LYS 75 307 14 Y 1 A ILE 76 ? A ILE 76 308 14 Y 1 A SER 77 ? A SER 77 309 15 Y 1 A LEU 56 ? A LEU 56 310 15 Y 1 A ASP 57 ? A ASP 57 311 15 Y 1 A ASN 58 ? A ASN 58 312 15 Y 1 A GLU 59 ? A GLU 59 313 15 Y 1 A LYS 60 ? A LYS 60 314 15 Y 1 A PRO 61 ? A PRO 61 315 15 Y 1 A ALA 62 ? A ALA 62 316 15 Y 1 A ALA 63 ? A ALA 63 317 15 Y 1 A VAL 64 ? A VAL 64 318 15 Y 1 A VAL 65 ? A VAL 65 319 15 Y 1 A ALA 66 ? A ALA 66 320 15 Y 1 A PRO 67 ? A PRO 67 321 15 Y 1 A LEU 68 ? A LEU 68 322 15 Y 1 A THR 69 ? A THR 69 323 15 Y 1 A THR 70 ? A THR 70 324 15 Y 1 A GLY 71 ? A GLY 71 325 15 Y 1 A TYR 72 ? A TYR 72 326 15 Y 1 A THR 73 ? A THR 73 327 15 Y 1 A VAL 74 ? A VAL 74 328 15 Y 1 A LYS 75 ? A LYS 75 329 15 Y 1 A ILE 76 ? A ILE 76 330 15 Y 1 A SER 77 ? A SER 77 331 16 Y 1 A LEU 56 ? A LEU 56 332 16 Y 1 A ASP 57 ? A ASP 57 333 16 Y 1 A ASN 58 ? A ASN 58 334 16 Y 1 A GLU 59 ? A GLU 59 335 16 Y 1 A LYS 60 ? A LYS 60 336 16 Y 1 A PRO 61 ? A PRO 61 337 16 Y 1 A ALA 62 ? A ALA 62 338 16 Y 1 A ALA 63 ? A ALA 63 339 16 Y 1 A VAL 64 ? A VAL 64 340 16 Y 1 A VAL 65 ? A VAL 65 341 16 Y 1 A ALA 66 ? A ALA 66 342 16 Y 1 A PRO 67 ? A PRO 67 343 16 Y 1 A LEU 68 ? A LEU 68 344 16 Y 1 A THR 69 ? A THR 69 345 16 Y 1 A THR 70 ? A THR 70 346 16 Y 1 A GLY 71 ? A GLY 71 347 16 Y 1 A TYR 72 ? A TYR 72 348 16 Y 1 A THR 73 ? A THR 73 349 16 Y 1 A VAL 74 ? A VAL 74 350 16 Y 1 A LYS 75 ? A LYS 75 351 16 Y 1 A ILE 76 ? A ILE 76 352 16 Y 1 A SER 77 ? A SER 77 353 17 Y 1 A LEU 56 ? A LEU 56 354 17 Y 1 A ASP 57 ? A ASP 57 355 17 Y 1 A ASN 58 ? A ASN 58 356 17 Y 1 A GLU 59 ? A GLU 59 357 17 Y 1 A LYS 60 ? A LYS 60 358 17 Y 1 A PRO 61 ? A PRO 61 359 17 Y 1 A ALA 62 ? A ALA 62 360 17 Y 1 A ALA 63 ? A ALA 63 361 17 Y 1 A VAL 64 ? A VAL 64 362 17 Y 1 A VAL 65 ? A VAL 65 363 17 Y 1 A ALA 66 ? A ALA 66 364 17 Y 1 A PRO 67 ? A PRO 67 365 17 Y 1 A LEU 68 ? A LEU 68 366 17 Y 1 A THR 69 ? A THR 69 367 17 Y 1 A THR 70 ? A THR 70 368 17 Y 1 A GLY 71 ? A GLY 71 369 17 Y 1 A TYR 72 ? A TYR 72 370 17 Y 1 A THR 73 ? A THR 73 371 17 Y 1 A VAL 74 ? A VAL 74 372 17 Y 1 A LYS 75 ? A LYS 75 373 17 Y 1 A ILE 76 ? A ILE 76 374 17 Y 1 A SER 77 ? A SER 77 375 18 Y 1 A LEU 56 ? A LEU 56 376 18 Y 1 A ASP 57 ? A ASP 57 377 18 Y 1 A ASN 58 ? A ASN 58 378 18 Y 1 A GLU 59 ? A GLU 59 379 18 Y 1 A LYS 60 ? A LYS 60 380 18 Y 1 A PRO 61 ? A PRO 61 381 18 Y 1 A ALA 62 ? A ALA 62 382 18 Y 1 A ALA 63 ? A ALA 63 383 18 Y 1 A VAL 64 ? A VAL 64 384 18 Y 1 A VAL 65 ? A VAL 65 385 18 Y 1 A ALA 66 ? A ALA 66 386 18 Y 1 A PRO 67 ? A PRO 67 387 18 Y 1 A LEU 68 ? A LEU 68 388 18 Y 1 A THR 69 ? A THR 69 389 18 Y 1 A THR 70 ? A THR 70 390 18 Y 1 A GLY 71 ? A GLY 71 391 18 Y 1 A TYR 72 ? A TYR 72 392 18 Y 1 A THR 73 ? A THR 73 393 18 Y 1 A VAL 74 ? A VAL 74 394 18 Y 1 A LYS 75 ? A LYS 75 395 18 Y 1 A ILE 76 ? A ILE 76 396 18 Y 1 A SER 77 ? A SER 77 397 19 Y 1 A LEU 56 ? A LEU 56 398 19 Y 1 A ASP 57 ? A ASP 57 399 19 Y 1 A ASN 58 ? A ASN 58 400 19 Y 1 A GLU 59 ? A GLU 59 401 19 Y 1 A LYS 60 ? A LYS 60 402 19 Y 1 A PRO 61 ? A PRO 61 403 19 Y 1 A ALA 62 ? A ALA 62 404 19 Y 1 A ALA 63 ? A ALA 63 405 19 Y 1 A VAL 64 ? A VAL 64 406 19 Y 1 A VAL 65 ? A VAL 65 407 19 Y 1 A ALA 66 ? A ALA 66 408 19 Y 1 A PRO 67 ? A PRO 67 409 19 Y 1 A LEU 68 ? A LEU 68 410 19 Y 1 A THR 69 ? A THR 69 411 19 Y 1 A THR 70 ? A THR 70 412 19 Y 1 A GLY 71 ? A GLY 71 413 19 Y 1 A TYR 72 ? A TYR 72 414 19 Y 1 A THR 73 ? A THR 73 415 19 Y 1 A VAL 74 ? A VAL 74 416 19 Y 1 A LYS 75 ? A LYS 75 417 19 Y 1 A ILE 76 ? A ILE 76 418 19 Y 1 A SER 77 ? A SER 77 419 20 Y 1 A LEU 56 ? A LEU 56 420 20 Y 1 A ASP 57 ? A ASP 57 421 20 Y 1 A ASN 58 ? A ASN 58 422 20 Y 1 A GLU 59 ? A GLU 59 423 20 Y 1 A LYS 60 ? A LYS 60 424 20 Y 1 A PRO 61 ? A PRO 61 425 20 Y 1 A ALA 62 ? A ALA 62 426 20 Y 1 A ALA 63 ? A ALA 63 427 20 Y 1 A VAL 64 ? A VAL 64 428 20 Y 1 A VAL 65 ? A VAL 65 429 20 Y 1 A ALA 66 ? A ALA 66 430 20 Y 1 A PRO 67 ? A PRO 67 431 20 Y 1 A LEU 68 ? A LEU 68 432 20 Y 1 A THR 69 ? A THR 69 433 20 Y 1 A THR 70 ? A THR 70 434 20 Y 1 A GLY 71 ? A GLY 71 435 20 Y 1 A TYR 72 ? A TYR 72 436 20 Y 1 A THR 73 ? A THR 73 437 20 Y 1 A VAL 74 ? A VAL 74 438 20 Y 1 A LYS 75 ? A LYS 75 439 20 Y 1 A ILE 76 ? A ILE 76 440 20 Y 1 A SER 77 ? A SER 77 #