data_1YUG # _entry.id 1YUG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1YUG WWPDB D_1000177446 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YUG _pdbx_database_status.recvd_initial_deposition_date 1996-04-01 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Moy, F.J.' 1 'Montelione, G.T.' 2 'Scheraga, H.A.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure of human type-alpha transforming growth factor determined by heteronuclear NMR spectroscopy and refined by energy minimization with restraints. ; Biochemistry 32 7334 7353 1993 BICHAW US 0006-2960 0033 ? 8338831 10.1021/bi00080a003 1 'Crankshaft Motions of the Polypeptide Backbone in Molecular Dynamics Simulations of Human Type-Alpha Transforming Growth Factor' J.Biomol.NMR 6 221 ? 1995 JBNME9 NE 0925-2738 0800 ? ? ? 2 ;Human Type-Alpha Transforming Growth Factor Undergoes Slow Conformational Exchange between Multiple Backbone Conformations as Characterized by Nitrogen-15 Relaxation Measurements ; Biochemistry 34 2408 ? 1995 BICHAW US 0006-2960 0033 ? ? ? 3 ;Sequence-Specific 1H-NMR Assignments and Identification of Two Small Antiparallel Beta-Sheets in the Solution Structure of Recombinant Human Transforming Growth Factor Alpha ; Proc.Natl.Acad.Sci.USA 86 1519 ? 1989 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Moy, F.J.' 1 primary 'Li, Y.C.' 2 primary 'Rauenbuehler, P.' 3 primary 'Winkler, M.E.' 4 primary 'Scheraga, H.A.' 5 primary 'Montelione, G.T.' 6 1 'Fadel, A.R.' 7 1 'Jin, D.Q.' 8 1 'Montelione, G.T.' 9 1 'Levy, R.M.' 10 2 'Li, Y.C.' 11 2 'Montelione, G.T.' 12 3 'Montelione, G.T.' 13 3 'Winkler, M.E.' 14 3 'Burton, L.E.' 15 3 'Rinderknecht, E.' 16 3 'Sporn, M.B.' 17 3 'Wagner, G.' 18 # _cell.entry_id 1YUG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1YUG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TRANSFORMING GROWTH FACTOR ALPHA' _entity.formula_weight 5560.246 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TGF-ALPHA, H-TGF-ALPHA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA _entity_poly.pdbx_seq_one_letter_code_can VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 SER n 1 4 HIS n 1 5 PHE n 1 6 ASN n 1 7 ASP n 1 8 CYS n 1 9 PRO n 1 10 ASP n 1 11 SER n 1 12 HIS n 1 13 THR n 1 14 GLN n 1 15 PHE n 1 16 CYS n 1 17 PHE n 1 18 HIS n 1 19 GLY n 1 20 THR n 1 21 CYS n 1 22 ARG n 1 23 PHE n 1 24 LEU n 1 25 VAL n 1 26 GLN n 1 27 GLU n 1 28 ASP n 1 29 LYS n 1 30 PRO n 1 31 ALA n 1 32 CYS n 1 33 VAL n 1 34 CYS n 1 35 HIS n 1 36 SER n 1 37 GLY n 1 38 TYR n 1 39 VAL n 1 40 GLY n 1 41 ALA n 1 42 ARG n 1 43 CYS n 1 44 GLU n 1 45 HIS n 1 46 ALA n 1 47 ASP n 1 48 LEU n 1 49 LEU n 1 50 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'HUMAN TGF-ALPHA 1YUG' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'HUMAN TGF-ALPHA 1YUG' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PTE5 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TGFA_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01135 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGA RCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YUG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01135 _struct_ref_seq.db_align_beg 40 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 50 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1YUG _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name ECEPP/3 _pdbx_nmr_software.version ? _pdbx_nmr_software.authors 'NEMETHY, SCHERAGA, ET AL.' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1YUG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1YUG _struct.title 'TYPE ALPHA TRANSFORMING GROWTH FACTOR, NMR, 15 MODELS AFTER ECEPP/3 ENERGY MINIMIZATION' _struct.pdbx_descriptor 'TRANSFORMING GROWTH FACTOR ALPHA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YUG _struct_keywords.pdbx_keywords 'GROWTH FACTOR' _struct_keywords.text 'EGF-LIKE DOMAIN STRUCTURE, GROWTH FACTOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 12 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 15 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 12 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 15 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 8 A CYS 21 1_555 ? ? ? ? ? ? ? 2.050 ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 16 A CYS 32 1_555 ? ? ? ? ? ? ? 1.934 ? disulf3 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 34 A CYS 43 1_555 ? ? ? ? ? ? ? 2.072 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 19 ? LEU A 24 ? GLY A 19 LEU A 24 A 2 LYS A 29 ? CYS A 34 ? LYS A 29 CYS A 34 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 20 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 20 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # _database_PDB_matrix.entry_id 1YUG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1YUG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ALA 50 50 50 ALA ALA A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-08-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? 71.88 -49.59 2 1 ASN A 6 ? ? -161.89 -62.99 3 1 ASP A 10 ? ? -155.33 37.51 4 1 SER A 11 ? ? 84.73 -40.17 5 1 ASP A 28 ? ? -24.82 95.88 6 1 ALA A 31 ? ? -161.57 114.82 7 1 HIS A 35 ? ? -88.03 -86.43 8 1 ASP A 47 ? ? 49.22 178.64 9 1 LEU A 49 ? ? -147.54 49.37 10 2 HIS A 4 ? ? -165.87 109.30 11 2 PHE A 5 ? ? 42.17 82.84 12 2 ASN A 6 ? ? 179.31 170.60 13 2 SER A 11 ? ? 97.86 -24.88 14 2 THR A 13 ? ? -41.27 -83.13 15 2 PHE A 15 ? ? 62.49 96.40 16 2 PHE A 17 ? ? -136.25 -48.28 17 2 LEU A 24 ? ? -69.71 87.26 18 2 ALA A 31 ? ? -177.99 137.15 19 2 HIS A 35 ? ? -102.71 -60.20 20 2 SER A 36 ? ? -103.71 53.42 21 2 TYR A 38 ? ? -57.43 -175.87 22 2 VAL A 39 ? ? -38.10 -72.11 23 2 ALA A 41 ? ? -67.66 -87.00 24 2 LEU A 49 ? ? -152.32 67.99 25 3 ASN A 6 ? ? -144.90 -65.35 26 3 CYS A 8 ? ? 177.24 -59.28 27 3 ASP A 10 ? ? -103.32 49.37 28 3 HIS A 12 ? ? 58.41 88.01 29 3 THR A 13 ? ? -91.86 -94.23 30 3 PHE A 15 ? ? -122.73 -57.95 31 3 LEU A 24 ? ? -64.16 99.79 32 3 ALA A 31 ? ? -163.88 117.45 33 3 VAL A 39 ? ? -87.05 -145.81 34 3 ALA A 41 ? ? -173.85 -82.89 35 3 LEU A 49 ? ? -156.12 70.53 36 4 SER A 3 ? ? 71.43 115.16 37 4 ASN A 6 ? ? -146.33 -55.62 38 4 ASP A 7 ? ? -75.23 -165.02 39 4 CYS A 8 ? ? -179.54 -59.33 40 4 HIS A 12 ? ? 65.67 83.63 41 4 THR A 13 ? ? -175.65 114.72 42 4 GLN A 14 ? ? 39.38 49.99 43 4 HIS A 18 ? ? -166.88 69.30 44 4 LEU A 24 ? ? -58.11 108.93 45 4 HIS A 35 ? ? -108.51 -71.63 46 4 ALA A 41 ? ? -154.92 -92.04 47 4 CYS A 43 ? ? 72.84 54.22 48 4 ASP A 47 ? ? 59.64 164.34 49 4 LEU A 48 ? ? 70.22 145.76 50 4 LEU A 49 ? ? -156.38 71.61 51 5 ASP A 7 ? ? 57.93 -159.14 52 5 CYS A 8 ? ? 171.48 -54.64 53 5 SER A 11 ? ? 50.88 78.04 54 5 HIS A 12 ? ? 79.60 -173.99 55 5 THR A 13 ? ? 83.14 -48.17 56 5 GLN A 14 ? ? -158.91 -93.69 57 5 PHE A 15 ? ? 49.61 -158.36 58 5 HIS A 18 ? ? -150.90 60.52 59 5 SER A 36 ? ? 69.76 157.17 60 5 LEU A 49 ? ? -141.73 -82.91 61 6 VAL A 2 ? ? 21.12 -92.60 62 6 ASN A 6 ? ? -148.09 -55.60 63 6 PRO A 9 ? ? -68.79 -97.39 64 6 ASP A 10 ? ? 172.32 42.61 65 6 HIS A 12 ? ? -69.26 86.95 66 6 GLN A 14 ? ? 81.88 -41.33 67 6 PHE A 15 ? ? 48.25 -163.78 68 6 ASP A 28 ? ? 35.28 69.39 69 6 ALA A 41 ? ? 61.06 -95.84 70 6 CYS A 43 ? ? 72.87 54.93 71 7 VAL A 2 ? ? -165.17 -45.80 72 7 ASN A 6 ? ? -133.21 -68.31 73 7 PRO A 9 ? ? -68.85 -176.22 74 7 THR A 13 ? ? 30.86 -105.11 75 7 HIS A 18 ? ? -160.25 96.20 76 7 ALA A 31 ? ? -164.97 106.68 77 7 HIS A 35 ? ? -109.78 47.31 78 7 SER A 36 ? ? 66.69 144.49 79 7 LEU A 49 ? ? -129.12 -98.04 80 8 VAL A 2 ? ? 28.28 -92.14 81 8 HIS A 4 ? ? 51.46 -175.83 82 8 ASN A 6 ? ? -147.26 -84.87 83 8 ASP A 10 ? ? -176.06 30.77 84 8 SER A 11 ? ? 54.85 162.75 85 8 HIS A 18 ? ? -160.10 94.88 86 8 ALA A 31 ? ? -172.47 124.53 87 8 HIS A 35 ? ? -100.40 -74.04 88 8 SER A 36 ? ? -177.71 148.82 89 8 VAL A 39 ? ? -139.01 -54.84 90 8 ALA A 46 ? ? -102.42 46.11 91 8 ASP A 47 ? ? 61.63 162.84 92 9 PHE A 5 ? ? 47.49 70.39 93 9 ASN A 6 ? ? -94.62 -157.07 94 9 CYS A 8 ? ? 66.64 104.93 95 9 PRO A 9 ? ? -68.73 -175.77 96 9 SER A 11 ? ? 31.64 -98.95 97 9 HIS A 18 ? ? -163.21 93.42 98 9 ALA A 31 ? ? -163.65 102.88 99 9 HIS A 35 ? ? 53.52 85.35 100 9 ARG A 42 ? ? -106.42 -76.28 101 9 CYS A 43 ? ? -159.65 32.73 102 9 LEU A 49 ? ? -135.89 -96.34 103 10 SER A 3 ? ? 69.65 149.87 104 10 ASP A 7 ? ? -37.36 103.55 105 10 ASP A 10 ? ? -147.62 18.41 106 10 SER A 11 ? ? 158.54 132.42 107 10 HIS A 18 ? ? -152.88 79.13 108 10 VAL A 25 ? ? -129.83 -56.34 109 10 ASP A 28 ? ? 36.29 57.15 110 10 ALA A 31 ? ? -171.19 113.05 111 10 SER A 36 ? ? 48.21 73.16 112 10 ALA A 41 ? ? 63.73 -88.81 113 10 LEU A 49 ? ? -122.09 -95.98 114 11 VAL A 2 ? ? 65.62 147.12 115 11 HIS A 4 ? ? -169.02 -45.89 116 11 PHE A 5 ? ? 166.08 161.82 117 11 ASN A 6 ? ? -169.23 -169.61 118 11 ASP A 7 ? ? -60.00 171.62 119 11 HIS A 12 ? ? 49.44 -95.17 120 11 THR A 13 ? ? 45.80 23.49 121 11 PHE A 15 ? ? -90.60 -154.71 122 11 ASP A 28 ? ? 39.61 52.80 123 11 ASP A 47 ? ? 60.25 163.30 124 12 HIS A 4 ? ? -153.85 -56.27 125 12 PHE A 5 ? ? 59.66 132.09 126 12 ASP A 7 ? ? 59.27 -179.71 127 12 ASP A 10 ? ? -125.09 -51.38 128 12 SER A 11 ? ? -63.60 89.46 129 12 HIS A 12 ? ? 50.89 96.89 130 12 THR A 13 ? ? -150.32 -74.04 131 12 PHE A 15 ? ? 50.45 101.70 132 12 HIS A 18 ? ? -116.54 51.47 133 12 THR A 20 ? ? -45.84 106.22 134 12 LEU A 24 ? ? -68.97 97.49 135 12 VAL A 39 ? ? -85.06 -84.52 136 12 ALA A 41 ? ? 60.94 -92.87 137 12 ARG A 42 ? ? -141.43 37.61 138 12 LEU A 48 ? ? -149.49 19.92 139 13 PRO A 9 ? ? -68.80 -170.95 140 13 ASP A 10 ? ? 81.46 -12.98 141 13 HIS A 12 ? ? 56.67 104.00 142 13 THR A 13 ? ? -151.50 -49.04 143 13 PHE A 15 ? ? -154.98 -52.64 144 13 HIS A 18 ? ? -109.65 61.41 145 13 ASP A 28 ? ? 38.70 72.06 146 13 ALA A 31 ? ? -164.73 117.59 147 13 HIS A 35 ? ? -90.04 -77.82 148 13 SER A 36 ? ? 169.88 169.94 149 13 VAL A 39 ? ? -83.56 -145.04 150 13 ALA A 41 ? ? 59.11 -96.79 151 13 ARG A 42 ? ? -148.80 37.59 152 13 LEU A 48 ? ? 65.06 -166.74 153 13 LEU A 49 ? ? -82.38 -87.77 154 14 VAL A 2 ? ? -143.43 -55.11 155 14 SER A 3 ? ? 67.31 161.16 156 14 PHE A 5 ? ? -178.83 72.61 157 14 ASN A 6 ? ? -153.41 -61.39 158 14 HIS A 12 ? ? 68.32 150.79 159 14 THR A 13 ? ? 82.18 -34.64 160 14 GLN A 14 ? ? -89.73 33.74 161 14 HIS A 18 ? ? -150.23 71.64 162 14 ASP A 28 ? ? 36.50 66.20 163 14 ALA A 31 ? ? -161.65 99.85 164 14 SER A 36 ? ? 70.30 146.56 165 14 VAL A 39 ? ? -144.04 -92.05 166 14 ARG A 42 ? ? 75.37 31.48 167 14 LEU A 48 ? ? 70.35 140.26 168 14 LEU A 49 ? ? -138.33 -96.08 169 15 PHE A 5 ? ? 49.05 73.45 170 15 ASN A 6 ? ? -108.43 -85.54 171 15 ASP A 7 ? ? -141.28 15.97 172 15 CYS A 8 ? ? 68.02 130.71 173 15 PRO A 9 ? ? -68.79 -178.77 174 15 GLN A 14 ? ? -107.00 -103.22 175 15 PHE A 15 ? ? 59.83 14.11 176 15 HIS A 18 ? ? -164.28 53.83 177 15 SER A 36 ? ? 75.32 138.68 178 15 VAL A 39 ? ? -145.38 -151.89 179 15 ALA A 41 ? ? 80.43 -66.82 180 15 CYS A 43 ? ? 69.66 74.11 181 15 GLU A 44 ? ? -136.91 -42.51 182 15 LEU A 49 ? ? -156.44 60.90 #