data_1YWX # _entry.id 1YWX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YWX pdb_00001ywx 10.2210/pdb1ywx/pdb RCSB RCSB032015 ? ? WWPDB D_1000032015 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-04-05 2 'Structure model' 1 1 2007-10-04 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2022-03-02 5 'Structure model' 2 1 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' database_2 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.Cartn_x' 2 4 'Structure model' '_atom_site.Cartn_y' 3 4 'Structure model' '_atom_site.Cartn_z' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YWX _pdbx_database_status.recvd_initial_deposition_date 2005-02-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id MrR16 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yang, C.S.' 1 'Acton, T.' 2 'Shen, Y.' 3 'Ma, L.' 4 'Liu, G.' 5 'Xiao, R.' 6 'Montelione, G.T.' 7 'Szyperski, T.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 # _citation.id primary _citation.title 'Solution Structure of Methanococcus maripaludis Protein MMP0443: The Northeast Structural Genomics Consortium Target MrR16' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, C.S.' 1 ? primary 'Acton, T.' 2 ? primary 'Shen, Y.' 3 ? primary 'Ma, L.' 4 ? primary 'Liu, G.' 5 ? primary 'Xiao, R.' 6 ? primary 'Montelione, G.T.' 7 ? primary 'Szyperski, T.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '30S ribosomal protein S24e' _entity.formula_weight 11472.084 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDISIISDRNNPLLQRREIKFTVSFDAATPSIKDVKMKLVAVLNANKQVLVVDTLDQIFGKLEAEGYAKIYNDEKAMATI ETKSVLEKNKIEEEAEAEVAEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MDISIISDRNNPLLQRREIKFTVSFDAATPSIKDVKMKLVAVLNANKQVLVVDTLDQIFGKLEAEGYAKIYNDEKAMATI ETKSVLEKNKIEEEAEAEVAEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MrR16 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ILE n 1 4 SER n 1 5 ILE n 1 6 ILE n 1 7 SER n 1 8 ASP n 1 9 ARG n 1 10 ASN n 1 11 ASN n 1 12 PRO n 1 13 LEU n 1 14 LEU n 1 15 GLN n 1 16 ARG n 1 17 ARG n 1 18 GLU n 1 19 ILE n 1 20 LYS n 1 21 PHE n 1 22 THR n 1 23 VAL n 1 24 SER n 1 25 PHE n 1 26 ASP n 1 27 ALA n 1 28 ALA n 1 29 THR n 1 30 PRO n 1 31 SER n 1 32 ILE n 1 33 LYS n 1 34 ASP n 1 35 VAL n 1 36 LYS n 1 37 MET n 1 38 LYS n 1 39 LEU n 1 40 VAL n 1 41 ALA n 1 42 VAL n 1 43 LEU n 1 44 ASN n 1 45 ALA n 1 46 ASN n 1 47 LYS n 1 48 GLN n 1 49 VAL n 1 50 LEU n 1 51 VAL n 1 52 VAL n 1 53 ASP n 1 54 THR n 1 55 LEU n 1 56 ASP n 1 57 GLN n 1 58 ILE n 1 59 PHE n 1 60 GLY n 1 61 LYS n 1 62 LEU n 1 63 GLU n 1 64 ALA n 1 65 GLU n 1 66 GLY n 1 67 TYR n 1 68 ALA n 1 69 LYS n 1 70 ILE n 1 71 TYR n 1 72 ASN n 1 73 ASP n 1 74 GLU n 1 75 LYS n 1 76 ALA n 1 77 MET n 1 78 ALA n 1 79 THR n 1 80 ILE n 1 81 GLU n 1 82 THR n 1 83 LYS n 1 84 SER n 1 85 VAL n 1 86 LEU n 1 87 GLU n 1 88 LYS n 1 89 ASN n 1 90 LYS n 1 91 ILE n 1 92 GLU n 1 93 GLU n 1 94 GLU n 1 95 ALA n 1 96 GLU n 1 97 ALA n 1 98 GLU n 1 99 VAL n 1 100 ALA n 1 101 GLU n 1 102 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Methanococcus _entity_src_gen.pdbx_gene_src_gene rps24e _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanococcus maripaludis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 39152 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLU 102 102 102 GLU GLU A . n # _cell.entry_id 1YWX _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1YWX _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1YWX _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1YWX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1YWX _struct.title 'Solution Structure of Methanococcus maripaludis Protein MMP0443: The Northeast Structural Genomics Consortium Target MrR16' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YWX _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;GFT NMR, MrR16, NESGC, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RS24_METMP _struct_ref.pdbx_db_accession P61193 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDISIISDRNNPLLQRREIKFTVSFDAATPSIKDVKMKLVAVLNANKQVLVVDTLDQIFGKLEAEGYAKIYNDEKAMATI ETKSVLEKNKIEEEAEAEVAEE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YWX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61193 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 102 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 31 ? ASN A 44 ? SER A 31 ASN A 44 1 ? 14 HELX_P HELX_P2 2 ASP A 73 ? ILE A 80 ? ASP A 73 ILE A 80 1 ? 8 HELX_P HELX_P3 3 THR A 82 ? ASN A 89 ? THR A 82 ASN A 89 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 2 ? ASN A 11 ? ASP A 2 ASN A 11 A 2 ARG A 16 ? SER A 24 ? ARG A 16 SER A 24 A 3 GLU A 63 ? ILE A 70 ? GLU A 63 ILE A 70 A 4 LEU A 50 ? GLN A 57 ? LEU A 50 GLN A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 9 ? N ARG A 9 O GLU A 18 ? O GLU A 18 A 2 3 N VAL A 23 ? N VAL A 23 O ALA A 64 ? O ALA A 64 A 3 4 O GLU A 65 ? O GLU A 65 N ASP A 56 ? N ASP A 56 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A VAL 23 ? ? O A ALA 64 ? ? 1.52 2 1 H A ILE 58 ? ? O A GLU 63 ? ? 1.53 3 1 O A LEU 39 ? ? H A LEU 43 ? ? 1.54 4 1 O A GLU 74 ? ? H A ALA 78 ? ? 1.57 5 2 O A LEU 39 ? ? H A LEU 43 ? ? 1.50 6 2 H A ILE 58 ? ? O A GLU 63 ? ? 1.50 7 2 H A VAL 23 ? ? O A ALA 64 ? ? 1.55 8 2 O A ALA 76 ? ? H A ILE 80 ? ? 1.59 9 3 O A LEU 39 ? ? H A LEU 43 ? ? 1.49 10 3 H A ILE 58 ? ? O A GLU 63 ? ? 1.50 11 3 H A VAL 23 ? ? O A ALA 64 ? ? 1.51 12 3 O A GLU 74 ? ? H A ALA 78 ? ? 1.58 13 3 O A ILE 32 ? ? H A LYS 36 ? ? 1.58 14 3 H A ILE 19 ? ? O A ALA 68 ? ? 1.59 15 4 O A ILE 32 ? ? H A LYS 36 ? ? 1.49 16 4 O A LEU 39 ? ? H A LEU 43 ? ? 1.50 17 4 H A ILE 58 ? ? O A GLU 63 ? ? 1.51 18 4 H A VAL 23 ? ? O A ALA 64 ? ? 1.52 19 4 H A ILE 6 ? ? O A LYS 20 ? ? 1.54 20 4 O A GLU 74 ? ? H A ALA 78 ? ? 1.54 21 4 O A ASP 2 ? ? H A SER 24 ? ? 1.59 22 5 O A GLU 74 ? ? H A ALA 78 ? ? 1.48 23 5 O A LEU 39 ? ? H A LEU 43 ? ? 1.48 24 5 H A ILE 58 ? ? O A GLU 63 ? ? 1.50 25 5 O A ILE 32 ? ? H A LYS 36 ? ? 1.55 26 5 O A ALA 76 ? ? H A ILE 80 ? ? 1.58 27 5 H A SER 4 ? ? O A THR 22 ? ? 1.60 28 6 O A LEU 39 ? ? H A LEU 43 ? ? 1.50 29 6 O A GLU 74 ? ? H A ALA 78 ? ? 1.54 30 6 H A VAL 23 ? ? O A ALA 64 ? ? 1.56 31 6 O A ALA 76 ? ? H A ILE 80 ? ? 1.56 32 6 OE2 A GLU 81 ? ? H A THR 82 ? ? 1.57 33 7 O A LEU 39 ? ? H A LEU 43 ? ? 1.50 34 7 H A ILE 58 ? ? O A GLU 63 ? ? 1.50 35 7 O A GLN 15 ? ? HD22 A ASN 72 ? ? 1.52 36 7 O A ILE 32 ? ? H A LYS 36 ? ? 1.57 37 8 H A VAL 23 ? ? O A ALA 64 ? ? 1.53 38 8 O A ALA 76 ? ? H A ILE 80 ? ? 1.54 39 8 O A ASN 11 ? ? H A ARG 16 ? ? 1.55 40 8 O A LEU 39 ? ? H A LEU 43 ? ? 1.56 41 9 O A GLU 74 ? ? H A ALA 78 ? ? 1.44 42 9 H A VAL 23 ? ? O A ALA 64 ? ? 1.49 43 9 O A ILE 32 ? ? H A LYS 36 ? ? 1.49 44 9 O A LEU 39 ? ? H A LEU 43 ? ? 1.54 45 10 O A GLU 74 ? ? H A ALA 78 ? ? 1.47 46 10 H A ILE 58 ? ? O A GLU 63 ? ? 1.50 47 10 O A LEU 39 ? ? H A LEU 43 ? ? 1.50 48 10 OE2 A GLU 81 ? ? H A THR 82 ? ? 1.52 49 10 H A VAL 23 ? ? O A ALA 64 ? ? 1.54 50 10 O A ALA 76 ? ? H A ILE 80 ? ? 1.55 51 11 O A LEU 39 ? ? H A LEU 43 ? ? 1.50 52 11 H A VAL 23 ? ? O A ALA 64 ? ? 1.51 53 11 O A ILE 32 ? ? H A LYS 36 ? ? 1.52 54 11 H A ILE 19 ? ? O A ALA 68 ? ? 1.53 55 11 O A GLU 74 ? ? H A ALA 78 ? ? 1.58 56 12 H A ILE 58 ? ? O A GLU 63 ? ? 1.49 57 12 O A ASP 2 ? ? H A SER 24 ? ? 1.49 58 12 O A LEU 39 ? ? H A LEU 43 ? ? 1.50 59 12 O A GLU 74 ? ? H A ALA 78 ? ? 1.58 60 12 O A SER 4 ? ? H A THR 22 ? ? 1.60 61 13 H A ILE 58 ? ? O A GLU 63 ? ? 1.45 62 13 O A LYS 47 ? ? H A LEU 50 ? ? 1.51 63 13 O A LEU 39 ? ? H A LEU 43 ? ? 1.53 64 13 O A GLU 74 ? ? H A ALA 78 ? ? 1.54 65 13 H A ARG 17 ? ? O A ILE 70 ? ? 1.57 66 13 O A ALA 76 ? ? H A ILE 80 ? ? 1.57 67 13 H A SER 4 ? ? O A THR 22 ? ? 1.58 68 14 O A LEU 39 ? ? H A LEU 43 ? ? 1.48 69 14 H A VAL 23 ? ? O A ALA 64 ? ? 1.51 70 14 O A ALA 76 ? ? H A ILE 80 ? ? 1.52 71 14 H A ILE 58 ? ? O A GLU 63 ? ? 1.54 72 14 O A GLU 74 ? ? H A ALA 78 ? ? 1.55 73 14 O A ILE 32 ? ? H A LYS 36 ? ? 1.57 74 14 H A ASP 53 ? ? O A TYR 67 ? ? 1.57 75 15 O A GLU 74 ? ? H A ALA 78 ? ? 1.49 76 15 O A LEU 39 ? ? H A LEU 43 ? ? 1.50 77 15 H A VAL 23 ? ? O A ALA 64 ? ? 1.50 78 15 O A ILE 32 ? ? H A LYS 36 ? ? 1.58 79 16 O A LEU 39 ? ? H A LEU 43 ? ? 1.48 80 16 H A VAL 23 ? ? O A ALA 64 ? ? 1.50 81 16 OE1 A GLU 81 ? ? H A LEU 86 ? ? 1.57 82 16 O A GLU 74 ? ? H A ALA 78 ? ? 1.59 83 16 O A ASN 11 ? ? H A ARG 16 ? ? 1.59 84 16 H A ILE 58 ? ? O A GLU 63 ? ? 1.59 85 17 O A LEU 39 ? ? H A LEU 43 ? ? 1.49 86 17 O A ILE 32 ? ? H A LYS 36 ? ? 1.49 87 17 H A VAL 23 ? ? O A ALA 64 ? ? 1.49 88 17 H A ILE 58 ? ? O A GLU 63 ? ? 1.49 89 17 O A GLU 74 ? ? H A ALA 78 ? ? 1.51 90 17 O A ASN 11 ? ? H A ARG 16 ? ? 1.52 91 17 O A ALA 76 ? ? H A ILE 80 ? ? 1.54 92 18 H A ILE 58 ? ? O A GLU 63 ? ? 1.51 93 18 O A LEU 39 ? ? H A LEU 43 ? ? 1.51 94 18 H A VAL 23 ? ? O A ALA 64 ? ? 1.52 95 18 O A ALA 76 ? ? H A ILE 80 ? ? 1.53 96 18 O A ILE 32 ? ? H A LYS 36 ? ? 1.54 97 18 OE2 A GLU 81 ? ? H A THR 82 ? ? 1.59 98 19 O A GLU 74 ? ? H A ALA 78 ? ? 1.47 99 19 O A LEU 39 ? ? H A LEU 43 ? ? 1.49 100 19 O A ILE 32 ? ? H A LYS 36 ? ? 1.50 101 19 O A ALA 76 ? ? H A ILE 80 ? ? 1.59 102 20 H A ILE 58 ? ? O A GLU 63 ? ? 1.46 103 20 O A LEU 39 ? ? H A LEU 43 ? ? 1.49 104 20 O A ILE 32 ? ? H A LYS 36 ? ? 1.51 105 20 O A GLU 74 ? ? H A ALA 78 ? ? 1.53 106 20 O A ALA 76 ? ? H A ILE 80 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 15 ? ? 39.37 38.16 2 1 ALA A 27 ? ? 75.80 -57.11 3 1 ALA A 28 ? ? -38.25 112.16 4 1 PRO A 30 ? ? -74.93 -162.11 5 1 SER A 31 ? ? -119.41 -169.09 6 1 ASN A 44 ? ? 65.71 61.55 7 1 VAL A 49 ? ? -96.55 52.78 8 1 LYS A 61 ? ? -120.55 -154.76 9 1 LEU A 62 ? ? -103.47 53.67 10 1 THR A 79 ? ? -92.88 -61.96 11 1 ILE A 80 ? ? -50.45 -79.00 12 1 GLU A 81 ? ? -45.80 171.38 13 1 ASN A 89 ? ? -41.09 108.48 14 1 ILE A 91 ? ? -57.67 -82.55 15 1 GLU A 94 ? ? -88.14 -158.02 16 1 ALA A 95 ? ? 164.53 86.16 17 1 GLU A 101 ? ? 57.62 164.08 18 2 GLN A 15 ? ? 38.08 35.73 19 2 ALA A 27 ? ? 163.04 -73.46 20 2 PRO A 30 ? ? -75.00 -162.02 21 2 VAL A 49 ? ? -110.04 57.49 22 2 LYS A 61 ? ? -139.01 -152.56 23 2 LEU A 62 ? ? -98.66 40.01 24 2 THR A 79 ? ? -96.70 -65.30 25 2 ILE A 80 ? ? -44.15 -73.76 26 2 GLU A 81 ? ? -47.31 172.71 27 2 ILE A 91 ? ? -63.73 -78.24 28 2 ALA A 95 ? ? 176.33 66.51 29 2 GLU A 101 ? ? 67.45 168.66 30 3 GLN A 15 ? ? 73.50 40.97 31 3 ALA A 27 ? ? 63.32 154.14 32 3 ALA A 28 ? ? 53.96 99.79 33 3 PRO A 30 ? ? -75.06 -161.97 34 3 VAL A 49 ? ? -99.25 53.86 35 3 LYS A 61 ? ? -127.80 -153.03 36 3 LEU A 62 ? ? -99.93 44.17 37 3 THR A 79 ? ? -99.96 -65.68 38 3 ILE A 80 ? ? -51.86 -81.07 39 3 GLU A 81 ? ? -37.75 148.54 40 3 ILE A 91 ? ? -52.02 -81.11 41 3 ALA A 95 ? ? 167.28 67.18 42 3 ALA A 97 ? ? 61.95 124.28 43 3 GLU A 98 ? ? -169.95 -48.04 44 3 GLU A 101 ? ? 73.43 168.58 45 4 ILE A 6 ? ? -94.05 -61.83 46 4 LEU A 13 ? ? -41.22 -80.67 47 4 GLN A 15 ? ? 70.06 47.41 48 4 ALA A 27 ? ? -176.93 -79.60 49 4 ALA A 28 ? ? -174.75 143.53 50 4 PRO A 30 ? ? -74.99 -90.21 51 4 VAL A 49 ? ? -105.65 58.48 52 4 LYS A 61 ? ? -143.66 -153.28 53 4 LEU A 62 ? ? -98.60 50.37 54 4 THR A 79 ? ? -92.49 -61.30 55 4 THR A 82 ? ? -129.81 -159.67 56 4 ILE A 91 ? ? -92.88 -63.39 57 4 GLU A 92 ? ? -50.62 173.92 58 4 ALA A 95 ? ? 178.55 94.62 59 4 GLU A 98 ? ? -170.86 -58.75 60 4 VAL A 99 ? ? 48.24 179.99 61 4 ALA A 100 ? ? -173.42 57.66 62 4 GLU A 101 ? ? 64.87 162.28 63 5 ARG A 16 ? ? -179.17 129.66 64 5 PHE A 25 ? ? -177.09 -177.64 65 5 ALA A 27 ? ? 48.28 -102.72 66 5 ALA A 28 ? ? 38.78 74.52 67 5 THR A 29 ? ? -44.12 102.81 68 5 PRO A 30 ? ? -75.07 -162.22 69 5 VAL A 49 ? ? -109.01 63.37 70 5 LYS A 61 ? ? -146.40 -150.11 71 5 LEU A 62 ? ? -98.86 37.77 72 5 THR A 79 ? ? -90.47 -63.93 73 5 ILE A 80 ? ? -45.47 -73.15 74 5 GLU A 81 ? ? -51.87 179.87 75 5 THR A 82 ? ? -124.10 -158.09 76 5 LYS A 90 ? ? -41.81 161.54 77 5 GLU A 92 ? ? 59.71 149.29 78 5 GLU A 94 ? ? -93.52 -157.75 79 5 ALA A 95 ? ? 168.18 67.65 80 5 ALA A 97 ? ? 61.29 151.84 81 5 GLU A 98 ? ? -168.10 -44.78 82 5 ALA A 100 ? ? -176.12 -73.20 83 6 LEU A 13 ? ? -40.11 -78.69 84 6 GLN A 15 ? ? 78.64 30.37 85 6 PHE A 25 ? ? -173.48 147.75 86 6 ALA A 27 ? ? -173.43 -83.96 87 6 PRO A 30 ? ? -74.99 -90.36 88 6 ASN A 44 ? ? 70.16 56.88 89 6 VAL A 49 ? ? -99.86 48.37 90 6 LYS A 61 ? ? -122.00 -145.67 91 6 ILE A 91 ? ? -121.59 -84.92 92 6 ALA A 95 ? ? 171.17 70.13 93 6 GLU A 98 ? ? -168.03 -52.15 94 7 GLN A 15 ? ? 80.81 33.62 95 7 ALA A 27 ? ? 63.36 155.95 96 7 ALA A 28 ? ? 72.81 100.94 97 7 PRO A 30 ? ? -75.00 -162.08 98 7 VAL A 49 ? ? -91.82 52.74 99 7 LYS A 61 ? ? -128.49 -154.50 100 7 LEU A 62 ? ? -98.43 41.74 101 7 THR A 79 ? ? -99.85 -65.54 102 7 ILE A 80 ? ? -40.42 -71.91 103 7 GLU A 81 ? ? -57.95 175.39 104 7 LYS A 90 ? ? -44.57 163.64 105 7 ILE A 91 ? ? -41.10 -72.57 106 7 GLU A 92 ? ? 65.35 -90.92 107 7 GLU A 94 ? ? -90.40 -159.84 108 7 ALA A 95 ? ? 165.23 96.56 109 7 VAL A 99 ? ? 48.20 -179.52 110 8 ILE A 6 ? ? -96.19 -61.85 111 8 GLN A 15 ? ? 38.06 49.50 112 8 ALA A 27 ? ? 176.17 -155.85 113 8 PRO A 30 ? ? -75.01 -90.22 114 8 ASN A 44 ? ? 60.97 74.78 115 8 VAL A 49 ? ? -104.53 55.33 116 8 ASP A 56 ? ? -161.91 118.36 117 8 LYS A 61 ? ? -115.54 -147.70 118 8 LYS A 90 ? ? -44.31 164.86 119 8 ILE A 91 ? ? -40.58 -88.67 120 8 GLU A 92 ? ? 59.74 149.94 121 8 GLU A 94 ? ? -86.35 -160.00 122 8 ALA A 95 ? ? 168.28 66.50 123 8 GLU A 98 ? ? -168.19 -60.57 124 8 VAL A 99 ? ? 44.86 102.02 125 8 GLU A 101 ? ? 61.48 166.62 126 9 ILE A 6 ? ? -96.64 -61.71 127 9 LEU A 13 ? ? -40.22 -79.03 128 9 GLN A 15 ? ? 70.01 49.07 129 9 PHE A 25 ? ? -176.47 146.33 130 9 ALA A 27 ? ? -178.14 -81.90 131 9 PRO A 30 ? ? -75.00 -161.92 132 9 VAL A 49 ? ? -109.89 52.10 133 9 THR A 54 ? ? -177.72 146.56 134 9 LYS A 61 ? ? -135.62 -145.28 135 9 THR A 82 ? ? -130.64 -157.02 136 9 ASN A 89 ? ? -48.78 103.71 137 9 ILE A 91 ? ? -126.48 -81.17 138 9 GLU A 92 ? ? -88.99 -91.41 139 9 ALA A 95 ? ? 173.43 93.64 140 9 ALA A 97 ? ? -172.72 126.46 141 9 GLU A 98 ? ? -43.94 -70.84 142 10 ALA A 27 ? ? 70.63 -60.17 143 10 ALA A 28 ? ? -38.51 109.68 144 10 PRO A 30 ? ? -75.04 -162.02 145 10 ASN A 44 ? ? 73.40 51.20 146 10 ALA A 45 ? ? -127.39 -169.40 147 10 LYS A 61 ? ? -134.78 -151.34 148 10 LEU A 62 ? ? -101.59 40.40 149 10 ALA A 64 ? ? -160.81 119.36 150 10 ILE A 80 ? ? -41.06 -70.34 151 10 THR A 82 ? ? -105.63 -167.71 152 10 LYS A 90 ? ? -42.54 163.24 153 10 ILE A 91 ? ? -47.23 -81.97 154 10 GLU A 94 ? ? -80.02 -149.80 155 10 ALA A 95 ? ? 63.92 89.91 156 10 GLU A 98 ? ? -167.76 -57.17 157 10 VAL A 99 ? ? 48.16 -179.58 158 10 ALA A 100 ? ? 179.13 176.61 159 10 GLU A 101 ? ? -50.47 170.12 160 11 GLN A 15 ? ? 70.74 59.17 161 11 ARG A 16 ? ? -177.88 142.64 162 11 ALA A 27 ? ? 59.29 155.28 163 11 ALA A 28 ? ? 65.47 136.83 164 11 PRO A 30 ? ? -75.06 -90.33 165 11 SER A 31 ? ? 179.94 -179.48 166 11 VAL A 49 ? ? -97.08 55.90 167 11 ASP A 56 ? ? -162.17 115.94 168 11 LYS A 61 ? ? -122.76 -153.29 169 11 LEU A 62 ? ? -107.19 44.35 170 11 THR A 79 ? ? -99.97 -66.14 171 11 ILE A 80 ? ? -46.67 -78.56 172 11 GLU A 81 ? ? -45.38 153.46 173 11 ILE A 91 ? ? -40.48 -79.43 174 11 ALA A 95 ? ? 171.68 65.68 175 11 ALA A 97 ? ? 62.73 124.85 176 11 GLU A 98 ? ? -169.15 -71.89 177 11 GLU A 101 ? ? -40.51 154.91 178 12 GLN A 15 ? ? 38.51 33.39 179 12 PHE A 25 ? ? -170.95 145.72 180 12 ALA A 27 ? ? 170.73 -93.04 181 12 PRO A 30 ? ? -75.05 -162.09 182 12 ASN A 44 ? ? 74.13 45.51 183 12 LYS A 61 ? ? -140.74 -151.49 184 12 LEU A 62 ? ? -97.84 44.92 185 12 ILE A 80 ? ? -47.27 -75.61 186 12 GLU A 81 ? ? -43.76 167.44 187 12 ILE A 91 ? ? -116.71 -86.90 188 12 ALA A 95 ? ? 165.69 96.93 189 12 ALA A 97 ? ? -170.35 125.25 190 13 GLN A 15 ? ? 72.92 50.61 191 13 ASP A 26 ? ? -157.89 68.51 192 13 ALA A 27 ? ? 160.87 -76.60 193 13 PRO A 30 ? ? -75.08 -90.22 194 13 ASN A 44 ? ? 71.07 63.37 195 13 LYS A 47 ? ? -112.44 -133.04 196 13 GLN A 48 ? ? 34.72 -95.89 197 13 LYS A 61 ? ? -144.35 -156.37 198 13 LEU A 62 ? ? -93.74 39.83 199 13 THR A 79 ? ? -91.54 -65.09 200 13 ILE A 91 ? ? -113.62 -90.22 201 13 ALA A 95 ? ? -178.44 92.96 202 13 GLU A 98 ? ? -168.46 -72.24 203 14 ILE A 6 ? ? -94.49 -60.54 204 14 ALA A 27 ? ? 59.73 153.27 205 14 ALA A 28 ? ? 61.91 128.72 206 14 PRO A 30 ? ? -74.96 -90.11 207 14 SER A 31 ? ? 177.80 -179.93 208 14 VAL A 49 ? ? 49.01 25.75 209 14 LYS A 61 ? ? -142.99 -153.69 210 14 LEU A 62 ? ? -97.59 49.15 211 14 ILE A 80 ? ? -40.23 -71.18 212 14 THR A 82 ? ? -121.41 -160.50 213 14 LYS A 90 ? ? -39.71 151.22 214 14 ILE A 91 ? ? -71.77 -80.61 215 14 GLU A 92 ? ? 67.30 147.79 216 14 GLU A 94 ? ? -93.88 -155.35 217 14 ALA A 95 ? ? 64.45 80.64 218 14 ALA A 97 ? ? 60.94 150.32 219 14 GLU A 98 ? ? -168.28 -72.15 220 14 ALA A 100 ? ? 176.52 178.05 221 15 GLN A 15 ? ? 83.60 27.63 222 15 PHE A 25 ? ? -171.50 148.64 223 15 ALA A 27 ? ? 175.19 -80.09 224 15 PRO A 30 ? ? -74.92 -90.06 225 15 ASN A 44 ? ? 59.11 71.02 226 15 VAL A 49 ? ? -96.11 53.55 227 15 LYS A 61 ? ? -122.96 -145.33 228 15 ASN A 72 ? ? -133.77 -46.88 229 15 THR A 79 ? ? -99.40 -65.28 230 15 ILE A 80 ? ? -41.51 -70.78 231 15 ASN A 89 ? ? -93.04 31.59 232 15 LYS A 90 ? ? -43.80 164.30 233 15 ILE A 91 ? ? -64.75 -94.56 234 15 GLU A 94 ? ? -85.01 -155.39 235 15 ALA A 95 ? ? 64.76 90.25 236 15 GLU A 98 ? ? -169.23 -49.31 237 15 ALA A 100 ? ? -176.98 76.58 238 16 LEU A 13 ? ? -41.62 -75.92 239 16 ALA A 27 ? ? 70.61 -60.09 240 16 ALA A 28 ? ? -38.77 112.04 241 16 PRO A 30 ? ? -75.06 -162.14 242 16 ASN A 44 ? ? 67.91 76.21 243 16 VAL A 49 ? ? -116.70 56.24 244 16 LYS A 61 ? ? -110.43 -144.06 245 16 THR A 79 ? ? -99.88 -67.42 246 16 GLU A 81 ? ? -46.81 174.41 247 16 ASN A 89 ? ? -40.18 109.65 248 16 LYS A 90 ? ? -40.39 158.99 249 16 ILE A 91 ? ? -40.88 -84.89 250 16 GLU A 92 ? ? 61.48 149.16 251 16 ALA A 95 ? ? 170.60 68.22 252 17 GLN A 15 ? ? 70.54 63.88 253 17 ARG A 16 ? ? -177.78 142.09 254 17 ALA A 27 ? ? 75.77 -59.11 255 17 ALA A 28 ? ? -40.07 102.20 256 17 PRO A 30 ? ? -74.96 -162.18 257 17 VAL A 49 ? ? -115.23 50.60 258 17 LYS A 61 ? ? -148.77 -153.88 259 17 LEU A 62 ? ? -90.37 40.94 260 17 THR A 82 ? ? -125.27 -163.03 261 17 LYS A 90 ? ? -43.49 158.24 262 17 ILE A 91 ? ? -117.63 -76.32 263 17 GLU A 94 ? ? -81.18 -156.60 264 17 ALA A 95 ? ? 170.33 95.73 265 17 ALA A 97 ? ? 61.78 151.20 266 17 GLU A 98 ? ? -167.75 -46.79 267 18 ILE A 6 ? ? -93.14 -64.11 268 18 LEU A 13 ? ? -39.92 -76.16 269 18 GLN A 15 ? ? 76.05 34.24 270 18 ALA A 27 ? ? -177.12 -82.28 271 18 PRO A 30 ? ? -74.94 -162.07 272 18 ASN A 44 ? ? 70.49 64.73 273 18 LYS A 61 ? ? -142.10 -154.52 274 18 LEU A 62 ? ? -92.30 39.62 275 18 THR A 82 ? ? -122.36 -164.41 276 18 ILE A 91 ? ? -116.30 -80.92 277 18 GLU A 93 ? ? -78.13 -169.41 278 18 GLU A 94 ? ? -79.20 -155.03 279 18 ALA A 97 ? ? 63.11 128.90 280 18 GLU A 98 ? ? -168.07 -55.64 281 18 VAL A 99 ? ? 44.52 102.08 282 18 GLU A 101 ? ? 82.67 164.24 283 19 LEU A 13 ? ? -40.71 -75.17 284 19 GLN A 15 ? ? 73.57 40.76 285 19 ALA A 27 ? ? 71.80 -59.46 286 19 ALA A 28 ? ? -38.77 108.48 287 19 PRO A 30 ? ? -75.00 -162.13 288 19 ASN A 44 ? ? 67.56 60.18 289 19 GLN A 48 ? ? -58.24 -71.28 290 19 LYS A 61 ? ? -114.80 -111.03 291 19 LEU A 62 ? ? -149.70 21.31 292 19 THR A 82 ? ? -103.98 -167.77 293 19 LYS A 90 ? ? -39.87 155.06 294 19 ILE A 91 ? ? -42.37 -88.04 295 19 GLU A 92 ? ? 67.76 147.90 296 19 ALA A 95 ? ? 173.96 67.40 297 19 ALA A 100 ? ? -176.32 137.99 298 20 LEU A 13 ? ? -40.34 -79.42 299 20 GLN A 15 ? ? 73.40 35.32 300 20 ALA A 27 ? ? -177.08 -78.88 301 20 PRO A 30 ? ? -75.05 -161.90 302 20 ASN A 44 ? ? 70.78 54.50 303 20 ASP A 56 ? ? -162.25 117.91 304 20 LYS A 61 ? ? -137.31 -156.32 305 20 LEU A 62 ? ? -91.98 45.64 306 20 ASN A 72 ? ? -75.44 -73.93 307 20 THR A 79 ? ? -99.30 -60.68 308 20 ILE A 80 ? ? -44.75 -74.97 309 20 GLU A 81 ? ? -56.10 175.78 310 20 ILE A 91 ? ? -109.88 -83.85 311 20 GLU A 92 ? ? -172.12 -90.52 312 20 ALA A 95 ? ? 169.68 87.09 313 20 GLU A 98 ? ? -168.14 -56.49 314 20 VAL A 99 ? ? 44.66 102.06 315 20 ALA A 100 ? ? -93.27 -69.66 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 1YWX _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1YWX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents U-15N,13C _pdbx_nmr_sample_details.solvent_system '5% D2O, 0.02% NaN3, 10mM DTT, 5mM CaCl2, 100mM NaCl, 20mM MES, pH6.5' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength N.A. _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 'GFT (4,3)D HNNCABCA' 1 2 1 'GFT (4,3)D CABCA(CO)NHN' 1 3 1 'GFT (4,3)D HABCAB(CO)NHN' 1 4 1 'GFT (4,3)D HCCH' 1 5 1 'Simultaneous Heteronuclear Resolved [1H,1H]-NOESY' 1 # _pdbx_nmr_refine.entry_id 1YWX _pdbx_nmr_refine.method ;simulated annealing torsion angle dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing PROSA 6.0 'Guentert, P' 1 'data analysis' XEASY 1.3.1.3 'Bartels, C' 2 'structure solution' DYANA 1.5 'Guentert, P' 3 refinement DYANA 1.5 'Guentert, P' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TYR N N N N 283 TYR CA C N S 284 TYR C C N N 285 TYR O O N N 286 TYR CB C N N 287 TYR CG C Y N 288 TYR CD1 C Y N 289 TYR CD2 C Y N 290 TYR CE1 C Y N 291 TYR CE2 C Y N 292 TYR CZ C Y N 293 TYR OH O N N 294 TYR OXT O N N 295 TYR H H N N 296 TYR H2 H N N 297 TYR HA H N N 298 TYR HB2 H N N 299 TYR HB3 H N N 300 TYR HD1 H N N 301 TYR HD2 H N N 302 TYR HE1 H N N 303 TYR HE2 H N N 304 TYR HH H N N 305 TYR HXT H N N 306 VAL N N N N 307 VAL CA C N S 308 VAL C C N N 309 VAL O O N N 310 VAL CB C N N 311 VAL CG1 C N N 312 VAL CG2 C N N 313 VAL OXT O N N 314 VAL H H N N 315 VAL H2 H N N 316 VAL HA H N N 317 VAL HB H N N 318 VAL HG11 H N N 319 VAL HG12 H N N 320 VAL HG13 H N N 321 VAL HG21 H N N 322 VAL HG22 H N N 323 VAL HG23 H N N 324 VAL HXT H N N 325 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TYR N CA sing N N 270 TYR N H sing N N 271 TYR N H2 sing N N 272 TYR CA C sing N N 273 TYR CA CB sing N N 274 TYR CA HA sing N N 275 TYR C O doub N N 276 TYR C OXT sing N N 277 TYR CB CG sing N N 278 TYR CB HB2 sing N N 279 TYR CB HB3 sing N N 280 TYR CG CD1 doub Y N 281 TYR CG CD2 sing Y N 282 TYR CD1 CE1 sing Y N 283 TYR CD1 HD1 sing N N 284 TYR CD2 CE2 doub Y N 285 TYR CD2 HD2 sing N N 286 TYR CE1 CZ doub Y N 287 TYR CE1 HE1 sing N N 288 TYR CE2 CZ sing Y N 289 TYR CE2 HE2 sing N N 290 TYR CZ OH sing N N 291 TYR OH HH sing N N 292 TYR OXT HXT sing N N 293 VAL N CA sing N N 294 VAL N H sing N N 295 VAL N H2 sing N N 296 VAL CA C sing N N 297 VAL CA CB sing N N 298 VAL CA HA sing N N 299 VAL C O doub N N 300 VAL C OXT sing N N 301 VAL CB CG1 sing N N 302 VAL CB CG2 sing N N 303 VAL CB HB sing N N 304 VAL CG1 HG11 sing N N 305 VAL CG1 HG12 sing N N 306 VAL CG1 HG13 sing N N 307 VAL CG2 HG21 sing N N 308 VAL CG2 HG22 sing N N 309 VAL CG2 HG23 sing N N 310 VAL OXT HXT sing N N 311 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 600 ? 2 INOVA Varian 750 ? # _atom_sites.entry_id 1YWX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_