data_1YX4 # _entry.id 1YX4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YX4 pdb_00001yx4 10.2210/pdb1yx4/pdb RCSB RCSB032022 ? ? WWPDB D_1000032022 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-04-19 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YX4 _pdbx_database_status.recvd_initial_deposition_date 2005-02-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1D3Z ubiquitin unspecified PDB 1TBE tetra-ubiquitin unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, Q.' 1 'Young, P.' 2 'Walters, K.J.' 3 # _citation.id primary _citation.title 'Structure of S5a bound to monoubiquitin provides a model for polyubiquitin recognition' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 348 _citation.page_first 727 _citation.page_last 739 _citation.year 2005 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15826667 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2005.03.007 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Q.' 1 ? primary 'Young, P.' 2 ? primary 'Walters, K.J.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '26S proteasome non-ATPase regulatory subunit 4' _entity.formula_weight 14360.612 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment '(poly)ubiquitin binding region' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name '26S proteasome regulatory subunit S5A, Rpn10, Multiubiquitin chain binding protein, Antisecretory factor-1, AF, ASF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHHHHHSSGHIEGRHMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTE DSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESA ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHHHHHSSGHIEGRHMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTE DSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 HIS n 1 17 ILE n 1 18 GLU n 1 19 GLY n 1 20 ARG n 1 21 HIS n 1 22 MET n 1 23 LEU n 1 24 GLY n 1 25 LEU n 1 26 GLY n 1 27 ALA n 1 28 SER n 1 29 ASP n 1 30 PHE n 1 31 GLU n 1 32 PHE n 1 33 GLY n 1 34 VAL n 1 35 ASP n 1 36 PRO n 1 37 SER n 1 38 ALA n 1 39 ASP n 1 40 PRO n 1 41 GLU n 1 42 LEU n 1 43 ALA n 1 44 LEU n 1 45 ALA n 1 46 LEU n 1 47 ARG n 1 48 VAL n 1 49 SER n 1 50 MET n 1 51 GLU n 1 52 GLU n 1 53 GLN n 1 54 ARG n 1 55 GLN n 1 56 ARG n 1 57 GLN n 1 58 GLU n 1 59 GLU n 1 60 GLU n 1 61 ALA n 1 62 ARG n 1 63 ARG n 1 64 ALA n 1 65 ALA n 1 66 ALA n 1 67 ALA n 1 68 SER n 1 69 ALA n 1 70 ALA n 1 71 GLU n 1 72 ALA n 1 73 GLY n 1 74 ILE n 1 75 ALA n 1 76 THR n 1 77 THR n 1 78 GLY n 1 79 THR n 1 80 GLU n 1 81 ASP n 1 82 SER n 1 83 ASP n 1 84 ASP n 1 85 ALA n 1 86 LEU n 1 87 LEU n 1 88 LYS n 1 89 MET n 1 90 THR n 1 91 ILE n 1 92 SER n 1 93 GLN n 1 94 GLN n 1 95 GLU n 1 96 PHE n 1 97 GLY n 1 98 ARG n 1 99 THR n 1 100 GLY n 1 101 LEU n 1 102 PRO n 1 103 ASP n 1 104 LEU n 1 105 SER n 1 106 SER n 1 107 MET n 1 108 THR n 1 109 GLU n 1 110 GLU n 1 111 GLU n 1 112 GLN n 1 113 ILE n 1 114 ALA n 1 115 TYR n 1 116 ALA n 1 117 MET n 1 118 GLN n 1 119 MET n 1 120 SER n 1 121 LEU n 1 122 GLN n 1 123 GLY n 1 124 ALA n 1 125 GLU n 1 126 PHE n 1 127 GLY n 1 128 GLN n 1 129 ALA n 1 130 GLU n 1 131 SER n 1 132 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'PSMD4, MCB1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 HIS 3 -17 ? ? ? A . n A 1 4 HIS 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 HIS 11 -9 ? ? ? A . n A 1 12 HIS 12 -8 ? ? ? A . n A 1 13 SER 13 -7 ? ? ? A . n A 1 14 SER 14 -6 ? ? ? A . n A 1 15 GLY 15 -5 ? ? ? A . n A 1 16 HIS 16 -4 ? ? ? A . n A 1 17 ILE 17 -3 ? ? ? A . n A 1 18 GLU 18 -2 ? ? ? A . n A 1 19 GLY 19 -1 ? ? ? A . n A 1 20 ARG 20 0 ? ? ? A . n A 1 21 HIS 21 1 1 HIS HIS A . n A 1 22 MET 22 2 2 MET MET A . n A 1 23 LEU 23 3 3 LEU LEU A . n A 1 24 GLY 24 4 4 GLY GLY A . n A 1 25 LEU 25 5 5 LEU LEU A . n A 1 26 GLY 26 6 6 GLY GLY A . n A 1 27 ALA 27 7 7 ALA ALA A . n A 1 28 SER 28 8 8 SER SER A . n A 1 29 ASP 29 9 9 ASP ASP A . n A 1 30 PHE 30 10 10 PHE PHE A . n A 1 31 GLU 31 11 11 GLU GLU A . n A 1 32 PHE 32 12 12 PHE PHE A . n A 1 33 GLY 33 13 13 GLY GLY A . n A 1 34 VAL 34 14 14 VAL VAL A . n A 1 35 ASP 35 15 15 ASP ASP A . n A 1 36 PRO 36 16 16 PRO PRO A . n A 1 37 SER 37 17 17 SER SER A . n A 1 38 ALA 38 18 18 ALA ALA A . n A 1 39 ASP 39 19 19 ASP ASP A . n A 1 40 PRO 40 20 20 PRO PRO A . n A 1 41 GLU 41 21 21 GLU GLU A . n A 1 42 LEU 42 22 22 LEU LEU A . n A 1 43 ALA 43 23 23 ALA ALA A . n A 1 44 LEU 44 24 24 LEU LEU A . n A 1 45 ALA 45 25 25 ALA ALA A . n A 1 46 LEU 46 26 26 LEU LEU A . n A 1 47 ARG 47 27 27 ARG ARG A . n A 1 48 VAL 48 28 28 VAL VAL A . n A 1 49 SER 49 29 29 SER SER A . n A 1 50 MET 50 30 30 MET MET A . n A 1 51 GLU 51 31 31 GLU GLU A . n A 1 52 GLU 52 32 32 GLU GLU A . n A 1 53 GLN 53 33 33 GLN GLN A . n A 1 54 ARG 54 34 34 ARG ARG A . n A 1 55 GLN 55 35 35 GLN GLN A . n A 1 56 ARG 56 36 36 ARG ARG A . n A 1 57 GLN 57 37 37 GLN GLN A . n A 1 58 GLU 58 38 38 GLU GLU A . n A 1 59 GLU 59 39 39 GLU GLU A . n A 1 60 GLU 60 40 40 GLU GLU A . n A 1 61 ALA 61 41 41 ALA ALA A . n A 1 62 ARG 62 42 42 ARG ARG A . n A 1 63 ARG 63 43 43 ARG ARG A . n A 1 64 ALA 64 44 44 ALA ALA A . n A 1 65 ALA 65 45 45 ALA ALA A . n A 1 66 ALA 66 46 46 ALA ALA A . n A 1 67 ALA 67 47 47 ALA ALA A . n A 1 68 SER 68 48 48 SER SER A . n A 1 69 ALA 69 49 49 ALA ALA A . n A 1 70 ALA 70 50 50 ALA ALA A . n A 1 71 GLU 71 51 51 GLU GLU A . n A 1 72 ALA 72 52 52 ALA ALA A . n A 1 73 GLY 73 53 53 GLY GLY A . n A 1 74 ILE 74 54 54 ILE ILE A . n A 1 75 ALA 75 55 55 ALA ALA A . n A 1 76 THR 76 56 56 THR THR A . n A 1 77 THR 77 57 57 THR THR A . n A 1 78 GLY 78 58 58 GLY GLY A . n A 1 79 THR 79 59 59 THR THR A . n A 1 80 GLU 80 60 60 GLU GLU A . n A 1 81 ASP 81 61 61 ASP ASP A . n A 1 82 SER 82 62 62 SER SER A . n A 1 83 ASP 83 63 63 ASP ASP A . n A 1 84 ASP 84 64 64 ASP ASP A . n A 1 85 ALA 85 65 65 ALA ALA A . n A 1 86 LEU 86 66 66 LEU LEU A . n A 1 87 LEU 87 67 67 LEU LEU A . n A 1 88 LYS 88 68 68 LYS LYS A . n A 1 89 MET 89 69 69 MET MET A . n A 1 90 THR 90 70 70 THR THR A . n A 1 91 ILE 91 71 71 ILE ILE A . n A 1 92 SER 92 72 72 SER SER A . n A 1 93 GLN 93 73 73 GLN GLN A . n A 1 94 GLN 94 74 74 GLN GLN A . n A 1 95 GLU 95 75 75 GLU GLU A . n A 1 96 PHE 96 76 76 PHE PHE A . n A 1 97 GLY 97 77 77 GLY GLY A . n A 1 98 ARG 98 78 78 ARG ARG A . n A 1 99 THR 99 79 79 THR THR A . n A 1 100 GLY 100 80 80 GLY GLY A . n A 1 101 LEU 101 81 81 LEU LEU A . n A 1 102 PRO 102 82 82 PRO PRO A . n A 1 103 ASP 103 83 83 ASP ASP A . n A 1 104 LEU 104 84 84 LEU LEU A . n A 1 105 SER 105 85 85 SER SER A . n A 1 106 SER 106 86 86 SER SER A . n A 1 107 MET 107 87 87 MET MET A . n A 1 108 THR 108 88 88 THR THR A . n A 1 109 GLU 109 89 89 GLU GLU A . n A 1 110 GLU 110 90 90 GLU GLU A . n A 1 111 GLU 111 91 91 GLU GLU A . n A 1 112 GLN 112 92 92 GLN GLN A . n A 1 113 ILE 113 93 93 ILE ILE A . n A 1 114 ALA 114 94 94 ALA ALA A . n A 1 115 TYR 115 95 95 TYR TYR A . n A 1 116 ALA 116 96 96 ALA ALA A . n A 1 117 MET 117 97 97 MET MET A . n A 1 118 GLN 118 98 98 GLN GLN A . n A 1 119 MET 119 99 99 MET MET A . n A 1 120 SER 120 100 100 SER SER A . n A 1 121 LEU 121 101 101 LEU LEU A . n A 1 122 GLN 122 102 102 GLN GLN A . n A 1 123 GLY 123 103 103 GLY GLY A . n A 1 124 ALA 124 104 104 ALA ALA A . n A 1 125 GLU 125 105 105 GLU GLU A . n A 1 126 PHE 126 106 106 PHE PHE A . n A 1 127 GLY 127 107 107 GLY GLY A . n A 1 128 GLN 128 108 108 GLN GLN A . n A 1 129 ALA 129 109 109 ALA ALA A . n A 1 130 GLU 130 110 110 GLU GLU A . n A 1 131 SER 131 111 111 SER SER A . n A 1 132 ALA 132 112 112 ALA ALA A . n # _cell.entry_id 1YX4 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1YX4 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1YX4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1YX4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1YX4 _struct.title 'Structure of S5a bound to monoubiquitin provides a model for polyubiquitin recognition' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YX4 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'polyubiquitin, proteasome, S5a, UIM, Hydrolase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PSD4_HUMAN _struct_ref.pdbx_db_accession P55036 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFG RTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESA ; _struct_ref.pdbx_align_begin 192 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YX4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 18 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 132 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55036 _struct_ref_seq.db_align_beg 192 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 306 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -2 _struct_ref_seq.pdbx_auth_seq_align_end 112 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1YX4 MET A 1 ? UNP P55036 ? ? 'cloning artifact' -19 1 1 1YX4 GLY A 2 ? UNP P55036 ? ? 'cloning artifact' -18 2 1 1YX4 HIS A 3 ? UNP P55036 ? ? 'expression tag' -17 3 1 1YX4 HIS A 4 ? UNP P55036 ? ? 'expression tag' -16 4 1 1YX4 HIS A 5 ? UNP P55036 ? ? 'expression tag' -15 5 1 1YX4 HIS A 6 ? UNP P55036 ? ? 'expression tag' -14 6 1 1YX4 HIS A 7 ? UNP P55036 ? ? 'expression tag' -13 7 1 1YX4 HIS A 8 ? UNP P55036 ? ? 'expression tag' -12 8 1 1YX4 HIS A 9 ? UNP P55036 ? ? 'expression tag' -11 9 1 1YX4 HIS A 10 ? UNP P55036 ? ? 'expression tag' -10 10 1 1YX4 HIS A 11 ? UNP P55036 ? ? 'expression tag' -9 11 1 1YX4 HIS A 12 ? UNP P55036 ? ? 'expression tag' -8 12 1 1YX4 SER A 13 ? UNP P55036 ? ? 'cloning artifact' -7 13 1 1YX4 SER A 14 ? UNP P55036 ? ? 'cloning artifact' -6 14 1 1YX4 GLY A 15 ? UNP P55036 ? ? 'cloning artifact' -5 15 1 1YX4 HIS A 16 ? UNP P55036 ? ? 'cloning artifact' -4 16 1 1YX4 ILE A 17 ? UNP P55036 ? ? 'cloning artifact' -3 17 1 1YX4 ARG A 20 ? UNP P55036 GLY 194 'cloning artifact' 0 18 1 1YX4 HIS A 21 ? UNP P55036 ALA 195 'cloning artifact' 1 19 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 36 ? ALA A 38 ? PRO A 16 ALA A 18 5 ? 3 HELX_P HELX_P2 2 PRO A 40 ? GLU A 71 ? PRO A 20 GLU A 51 1 ? 32 HELX_P HELX_P3 3 ASP A 83 ? GLU A 95 ? ASP A 63 GLU A 75 1 ? 13 HELX_P HELX_P4 4 GLU A 109 ? SER A 120 ? GLU A 89 SER A 100 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 5 ? ? -151.52 33.27 2 1 GLU A 11 ? ? -92.72 58.63 3 1 VAL A 14 ? ? -139.67 -40.34 4 1 GLU A 51 ? ? 52.39 79.07 5 1 THR A 59 ? ? -90.36 55.63 6 1 GLU A 60 ? ? -91.50 57.33 7 1 SER A 62 ? ? -117.56 72.38 8 1 LEU A 81 ? ? -175.53 111.76 9 1 SER A 86 ? ? -96.18 41.15 10 1 GLN A 102 ? ? -112.40 71.17 11 1 ALA A 104 ? ? -166.98 103.70 12 1 PHE A 106 ? ? -144.92 -60.18 13 1 GLN A 108 ? ? -102.14 58.40 14 2 GLU A 11 ? ? -159.43 34.69 15 2 PHE A 12 ? ? -161.74 -43.68 16 2 PRO A 16 ? ? -61.33 78.35 17 2 SER A 17 ? ? 70.28 47.30 18 2 ALA A 18 ? ? 44.64 27.27 19 2 ASP A 19 ? ? -169.44 119.06 20 2 THR A 56 ? ? -167.15 44.58 21 2 ASP A 61 ? ? -56.45 97.22 22 2 SER A 62 ? ? -50.74 79.54 23 2 LEU A 81 ? ? -180.00 112.33 24 2 ASP A 83 ? ? 52.45 74.77 25 2 SER A 86 ? ? -94.06 43.94 26 2 THR A 88 ? ? -60.45 -177.93 27 2 LEU A 101 ? ? -94.67 33.00 28 2 GLN A 102 ? ? -167.13 35.20 29 2 ALA A 104 ? ? -168.08 111.21 30 2 PHE A 106 ? ? -118.43 -71.43 31 2 GLN A 108 ? ? -104.47 56.89 32 2 SER A 111 ? ? -147.49 31.45 33 3 ALA A 7 ? ? -161.71 114.37 34 3 ASP A 15 ? ? -47.69 167.52 35 3 ASP A 19 ? ? -168.72 119.83 36 3 THR A 59 ? ? -112.00 73.17 37 3 GLU A 105 ? ? -151.73 54.61 38 3 PHE A 106 ? ? -96.80 -69.58 39 3 GLN A 108 ? ? -116.97 60.43 40 3 ALA A 109 ? ? -166.91 -51.33 41 4 MET A 2 ? ? -157.36 -47.15 42 4 LEU A 3 ? ? 79.39 33.23 43 4 PHE A 10 ? ? -171.45 44.78 44 4 PHE A 12 ? ? -166.26 -61.52 45 4 GLU A 51 ? ? -97.01 -67.94 46 4 GLU A 60 ? ? -159.66 78.49 47 4 ASP A 83 ? ? 53.31 90.22 48 4 LEU A 101 ? ? -93.90 46.21 49 4 GLN A 102 ? ? -165.36 -70.53 50 4 GLU A 105 ? ? -97.14 -136.04 51 4 GLU A 110 ? ? -133.14 -53.51 52 5 MET A 2 ? ? -168.30 -41.00 53 5 LEU A 3 ? ? 79.59 36.24 54 5 SER A 8 ? ? -99.08 31.75 55 5 PHE A 12 ? ? 35.51 35.17 56 5 ASP A 19 ? ? -167.17 118.66 57 5 GLU A 51 ? ? -153.85 -47.30 58 5 ALA A 55 ? ? -65.21 -172.84 59 5 THR A 79 ? ? -151.89 49.83 60 5 LEU A 81 ? ? -165.85 97.58 61 5 ASP A 83 ? ? 56.77 99.70 62 5 GLU A 105 ? ? -128.23 -60.64 63 6 MET A 2 ? ? 52.68 -163.17 64 6 ASP A 15 ? ? -61.90 -179.64 65 6 PRO A 16 ? ? -61.09 78.00 66 6 ALA A 18 ? ? 43.18 29.68 67 6 ASP A 19 ? ? -165.18 117.77 68 6 THR A 59 ? ? -169.05 77.06 69 6 LEU A 81 ? ? -163.26 94.36 70 6 ASP A 83 ? ? 60.24 112.56 71 6 SER A 86 ? ? -97.23 33.68 72 6 THR A 88 ? ? -66.55 -178.42 73 6 ALA A 104 ? ? -166.96 104.67 74 6 GLU A 105 ? ? 51.92 90.75 75 6 PHE A 106 ? ? -130.19 -52.45 76 6 GLN A 108 ? ? -160.25 59.96 77 6 ALA A 109 ? ? -145.33 32.66 78 6 GLU A 110 ? ? -143.39 51.27 79 7 MET A 2 ? ? 53.25 -178.30 80 7 ALA A 7 ? ? -99.82 31.57 81 7 SER A 8 ? ? -148.48 23.74 82 7 PHE A 12 ? ? 56.91 15.86 83 7 GLU A 60 ? ? -90.98 49.45 84 7 ASP A 61 ? ? -56.63 97.22 85 7 SER A 62 ? ? -50.52 81.33 86 7 ARG A 78 ? ? 55.97 101.49 87 7 LEU A 81 ? ? -165.93 99.25 88 7 ASP A 83 ? ? 52.25 92.82 89 7 GLN A 102 ? ? 51.83 85.22 90 7 PHE A 106 ? ? -152.39 -62.49 91 7 GLN A 108 ? ? -116.08 75.08 92 7 ALA A 109 ? ? -118.48 76.50 93 7 SER A 111 ? ? -92.37 50.10 94 8 LEU A 3 ? ? 79.67 35.15 95 8 LEU A 5 ? ? -134.55 -47.42 96 8 GLU A 11 ? ? -148.72 58.28 97 8 PHE A 12 ? ? -164.43 -55.14 98 8 ASP A 15 ? ? -52.54 173.27 99 8 ASP A 19 ? ? -167.60 119.88 100 8 ILE A 54 ? ? -80.49 -70.33 101 8 ALA A 55 ? ? 51.73 -165.11 102 8 GLU A 60 ? ? -103.06 46.74 103 8 ASP A 61 ? ? -56.21 97.07 104 8 SER A 62 ? ? -50.75 79.01 105 8 THR A 79 ? ? -145.46 27.38 106 8 LEU A 81 ? ? -161.72 94.73 107 8 ASP A 83 ? ? -110.51 64.58 108 8 ALA A 104 ? ? -160.65 110.32 109 8 ALA A 109 ? ? -122.76 -69.38 110 8 SER A 111 ? ? -137.30 -69.00 111 9 MET A 2 ? ? -167.68 -166.20 112 9 ALA A 7 ? ? -132.79 -62.26 113 9 PHE A 10 ? ? -153.17 24.82 114 9 VAL A 14 ? ? -144.77 -40.66 115 9 PRO A 16 ? ? -58.02 72.73 116 9 ALA A 18 ? ? 36.32 37.32 117 9 THR A 56 ? ? -164.01 56.10 118 9 THR A 79 ? ? -151.18 75.65 119 9 LEU A 81 ? ? -160.58 93.65 120 9 ASP A 83 ? ? 54.18 83.25 121 9 GLN A 102 ? ? -97.60 57.40 122 9 PHE A 106 ? ? -136.05 -44.01 123 9 ALA A 109 ? ? -167.63 103.63 124 9 GLU A 110 ? ? 51.95 93.99 125 10 ALA A 7 ? ? -97.93 30.25 126 10 SER A 8 ? ? -143.86 26.70 127 10 GLU A 11 ? ? -164.72 35.16 128 10 PHE A 12 ? ? -170.18 -44.36 129 10 ASP A 19 ? ? -167.98 118.21 130 10 GLU A 51 ? ? -134.38 -43.87 131 10 ILE A 54 ? ? -140.31 -42.04 132 10 ALA A 55 ? ? -175.04 -73.63 133 10 THR A 56 ? ? -113.06 -168.33 134 10 THR A 79 ? ? -143.10 16.68 135 10 LEU A 81 ? ? -174.89 95.56 136 10 GLN A 102 ? ? -105.17 42.64 137 10 ALA A 104 ? ? -162.04 81.15 138 10 PHE A 106 ? ? -154.46 85.42 139 10 GLN A 108 ? ? -94.02 52.63 140 10 GLU A 110 ? ? 61.34 -78.36 141 11 LEU A 5 ? ? 53.27 82.39 142 11 GLU A 11 ? ? -108.52 44.53 143 11 ASP A 15 ? ? 60.22 176.10 144 11 ILE A 54 ? ? -122.98 -140.01 145 11 ALA A 55 ? ? -158.54 -66.83 146 11 THR A 59 ? ? -117.68 55.42 147 11 ASP A 61 ? ? -100.50 -61.27 148 11 SER A 62 ? ? -114.17 79.59 149 11 LEU A 81 ? ? -162.90 95.61 150 11 PHE A 106 ? ? -151.94 -54.96 151 11 ALA A 109 ? ? -165.07 71.71 152 11 GLU A 110 ? ? 52.36 91.91 153 12 LEU A 5 ? ? -150.41 -71.74 154 12 GLU A 11 ? ? -167.51 49.49 155 12 PHE A 12 ? ? -147.25 26.73 156 12 GLU A 51 ? ? -149.56 -59.88 157 12 ILE A 54 ? ? -147.71 47.06 158 12 THR A 56 ? ? -151.44 57.08 159 12 ASP A 61 ? ? -55.75 97.35 160 12 SER A 62 ? ? -50.92 79.28 161 12 PHE A 76 ? ? -60.70 89.08 162 12 ASP A 83 ? ? 54.08 95.35 163 12 THR A 88 ? ? -65.26 -172.42 164 12 GLN A 102 ? ? 57.24 96.40 165 12 GLU A 105 ? ? 63.31 -75.00 166 12 PHE A 106 ? ? 73.22 -58.61 167 12 ALA A 109 ? ? -91.05 49.14 168 13 PHE A 10 ? ? -175.39 106.50 169 13 GLU A 11 ? ? -97.73 57.57 170 13 PHE A 12 ? ? -168.77 -54.07 171 13 PRO A 16 ? ? -61.67 78.25 172 13 SER A 17 ? ? 70.38 48.23 173 13 ALA A 18 ? ? 45.86 27.93 174 13 ASP A 19 ? ? -164.08 117.47 175 13 THR A 56 ? ? -141.35 52.84 176 13 GLU A 60 ? ? -90.28 59.47 177 13 SER A 62 ? ? -107.26 75.87 178 13 LEU A 81 ? ? -167.17 118.14 179 13 SER A 86 ? ? -103.52 46.39 180 13 THR A 88 ? ? -66.13 -173.17 181 13 ALA A 109 ? ? -151.15 62.87 182 13 SER A 111 ? ? -166.96 -44.90 183 14 MET A 2 ? ? 53.78 178.23 184 14 LEU A 5 ? ? 52.55 78.61 185 14 ASP A 19 ? ? -169.37 119.93 186 14 THR A 56 ? ? -108.68 58.58 187 14 THR A 57 ? ? -102.16 -169.50 188 14 THR A 59 ? ? -119.48 71.82 189 14 SER A 62 ? ? -117.93 79.44 190 14 PHE A 76 ? ? -60.01 94.81 191 14 ARG A 78 ? ? 53.58 95.69 192 14 LEU A 81 ? ? -172.94 104.79 193 14 LEU A 84 ? ? 58.38 -78.67 194 14 MET A 87 ? ? -109.21 -162.81 195 14 GLN A 102 ? ? -158.17 -72.18 196 15 MET A 2 ? ? -168.71 -168.82 197 15 ALA A 7 ? ? -62.31 -71.89 198 15 PHE A 12 ? ? -152.45 -51.34 199 15 ALA A 52 ? ? -142.89 18.16 200 15 ILE A 54 ? ? -148.64 -126.73 201 15 ALA A 55 ? ? 67.26 -70.00 202 15 THR A 56 ? ? -66.94 79.79 203 15 GLU A 60 ? ? -106.92 43.55 204 15 THR A 79 ? ? -153.08 -40.28 205 15 SER A 86 ? ? -97.76 34.99 206 15 ALA A 104 ? ? -165.04 98.34 207 15 GLU A 105 ? ? -119.25 71.65 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 27 ? ? 0.291 'SIDE CHAIN' 2 1 ARG A 34 ? ? 0.237 'SIDE CHAIN' 3 1 ARG A 36 ? ? 0.259 'SIDE CHAIN' 4 1 ARG A 42 ? ? 0.315 'SIDE CHAIN' 5 1 ARG A 43 ? ? 0.199 'SIDE CHAIN' 6 1 ARG A 78 ? ? 0.292 'SIDE CHAIN' 7 2 ARG A 27 ? ? 0.314 'SIDE CHAIN' 8 2 ARG A 34 ? ? 0.241 'SIDE CHAIN' 9 2 ARG A 36 ? ? 0.303 'SIDE CHAIN' 10 2 ARG A 42 ? ? 0.292 'SIDE CHAIN' 11 2 ARG A 43 ? ? 0.282 'SIDE CHAIN' 12 2 ARG A 78 ? ? 0.220 'SIDE CHAIN' 13 3 ARG A 27 ? ? 0.248 'SIDE CHAIN' 14 3 ARG A 34 ? ? 0.214 'SIDE CHAIN' 15 3 ARG A 36 ? ? 0.264 'SIDE CHAIN' 16 3 ARG A 42 ? ? 0.212 'SIDE CHAIN' 17 3 ARG A 43 ? ? 0.317 'SIDE CHAIN' 18 3 ARG A 78 ? ? 0.210 'SIDE CHAIN' 19 4 ARG A 27 ? ? 0.235 'SIDE CHAIN' 20 4 ARG A 34 ? ? 0.263 'SIDE CHAIN' 21 4 ARG A 36 ? ? 0.311 'SIDE CHAIN' 22 4 ARG A 42 ? ? 0.231 'SIDE CHAIN' 23 4 ARG A 43 ? ? 0.298 'SIDE CHAIN' 24 4 ARG A 78 ? ? 0.228 'SIDE CHAIN' 25 5 ARG A 27 ? ? 0.217 'SIDE CHAIN' 26 5 ARG A 34 ? ? 0.231 'SIDE CHAIN' 27 5 ARG A 36 ? ? 0.291 'SIDE CHAIN' 28 5 ARG A 42 ? ? 0.250 'SIDE CHAIN' 29 5 ARG A 43 ? ? 0.242 'SIDE CHAIN' 30 5 ARG A 78 ? ? 0.301 'SIDE CHAIN' 31 6 ARG A 27 ? ? 0.237 'SIDE CHAIN' 32 6 ARG A 34 ? ? 0.285 'SIDE CHAIN' 33 6 ARG A 36 ? ? 0.226 'SIDE CHAIN' 34 6 ARG A 42 ? ? 0.255 'SIDE CHAIN' 35 6 ARG A 43 ? ? 0.270 'SIDE CHAIN' 36 6 ARG A 78 ? ? 0.214 'SIDE CHAIN' 37 7 ARG A 27 ? ? 0.229 'SIDE CHAIN' 38 7 ARG A 34 ? ? 0.283 'SIDE CHAIN' 39 7 ARG A 36 ? ? 0.305 'SIDE CHAIN' 40 7 ARG A 42 ? ? 0.208 'SIDE CHAIN' 41 7 ARG A 43 ? ? 0.264 'SIDE CHAIN' 42 7 ARG A 78 ? ? 0.316 'SIDE CHAIN' 43 8 ARG A 27 ? ? 0.282 'SIDE CHAIN' 44 8 ARG A 34 ? ? 0.289 'SIDE CHAIN' 45 8 ARG A 36 ? ? 0.221 'SIDE CHAIN' 46 8 ARG A 42 ? ? 0.279 'SIDE CHAIN' 47 8 ARG A 43 ? ? 0.239 'SIDE CHAIN' 48 8 ARG A 78 ? ? 0.234 'SIDE CHAIN' 49 9 ARG A 27 ? ? 0.267 'SIDE CHAIN' 50 9 ARG A 34 ? ? 0.217 'SIDE CHAIN' 51 9 ARG A 36 ? ? 0.223 'SIDE CHAIN' 52 9 ARG A 42 ? ? 0.226 'SIDE CHAIN' 53 9 ARG A 43 ? ? 0.298 'SIDE CHAIN' 54 9 ARG A 78 ? ? 0.267 'SIDE CHAIN' 55 10 ARG A 27 ? ? 0.317 'SIDE CHAIN' 56 10 ARG A 34 ? ? 0.318 'SIDE CHAIN' 57 10 ARG A 36 ? ? 0.317 'SIDE CHAIN' 58 10 ARG A 42 ? ? 0.285 'SIDE CHAIN' 59 10 ARG A 43 ? ? 0.308 'SIDE CHAIN' 60 10 ARG A 78 ? ? 0.235 'SIDE CHAIN' 61 11 ARG A 27 ? ? 0.314 'SIDE CHAIN' 62 11 ARG A 34 ? ? 0.236 'SIDE CHAIN' 63 11 ARG A 36 ? ? 0.236 'SIDE CHAIN' 64 11 ARG A 42 ? ? 0.237 'SIDE CHAIN' 65 11 ARG A 43 ? ? 0.317 'SIDE CHAIN' 66 11 ARG A 78 ? ? 0.297 'SIDE CHAIN' 67 12 ARG A 27 ? ? 0.314 'SIDE CHAIN' 68 12 ARG A 34 ? ? 0.281 'SIDE CHAIN' 69 12 ARG A 36 ? ? 0.317 'SIDE CHAIN' 70 12 ARG A 42 ? ? 0.209 'SIDE CHAIN' 71 12 ARG A 43 ? ? 0.246 'SIDE CHAIN' 72 12 ARG A 78 ? ? 0.304 'SIDE CHAIN' 73 13 ARG A 27 ? ? 0.220 'SIDE CHAIN' 74 13 ARG A 34 ? ? 0.318 'SIDE CHAIN' 75 13 ARG A 36 ? ? 0.263 'SIDE CHAIN' 76 13 ARG A 42 ? ? 0.307 'SIDE CHAIN' 77 13 ARG A 43 ? ? 0.313 'SIDE CHAIN' 78 13 ARG A 78 ? ? 0.241 'SIDE CHAIN' 79 14 ARG A 27 ? ? 0.239 'SIDE CHAIN' 80 14 ARG A 34 ? ? 0.238 'SIDE CHAIN' 81 14 ARG A 36 ? ? 0.313 'SIDE CHAIN' 82 14 ARG A 42 ? ? 0.266 'SIDE CHAIN' 83 14 ARG A 43 ? ? 0.308 'SIDE CHAIN' 84 14 ARG A 78 ? ? 0.272 'SIDE CHAIN' 85 15 ARG A 27 ? ? 0.289 'SIDE CHAIN' 86 15 ARG A 34 ? ? 0.297 'SIDE CHAIN' 87 15 ARG A 36 ? ? 0.294 'SIDE CHAIN' 88 15 ARG A 42 ? ? 0.265 'SIDE CHAIN' 89 15 ARG A 43 ? ? 0.294 'SIDE CHAIN' 90 15 ARG A 78 ? ? 0.297 'SIDE CHAIN' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;Helix Determination Method: Author provided ; # _pdbx_nmr_ensemble.entry_id 1YX4 _pdbx_nmr_ensemble.conformers_calculated_total_number 15 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'back calculated data agree with experimental NOESY spectrum' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1YX4 _pdbx_nmr_representative.conformer_id 10 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.35 mM S5a U-15N, 13C' '20 mM phosphate buffer pH 6.5, 100 mM NaCl, 10% D2O' 2 '1 mM S5a U-15N' '20 mM phosphate buffer pH 6.5, 100 mM NaCl, 10% D2O' 3 '0.5 mM S5a unlabeled' '20 mM phosphate buffer pH 6.5, 100 mM NaCl, 10% D2O' 4 '0.5 mM S5a U-N15 and 50% Deuterated' '20 mM phosphate buffer pH 6.5, 100 mM NaCl, 10% D2O' 5 '1 mM S5a U-C13' '20 mM phosphate buffer pH 6.5, 100 mM NaCl, 10% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 1 6.5 '100 mM NaCl' atm K 2 283 1 6.5 '100 mM NaCl' atm K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 2 3D_15N-separated_NOESY 1 3 1 3D_13C-separated_NOESY 1 4 1 '2D NOESY' 1 5 2 '2D NOESY' 1 # _pdbx_nmr_refine.entry_id 1YX4 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' X-PLOR 3.851 ? 1 'data analysis' NMRPipe ? ? 2 refinement X-PLOR 3.851 ? 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A HIS -17 ? A HIS 3 4 1 Y 1 A HIS -16 ? A HIS 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A HIS -9 ? A HIS 11 12 1 Y 1 A HIS -8 ? A HIS 12 13 1 Y 1 A SER -7 ? A SER 13 14 1 Y 1 A SER -6 ? A SER 14 15 1 Y 1 A GLY -5 ? A GLY 15 16 1 Y 1 A HIS -4 ? A HIS 16 17 1 Y 1 A ILE -3 ? A ILE 17 18 1 Y 1 A GLU -2 ? A GLU 18 19 1 Y 1 A GLY -1 ? A GLY 19 20 1 Y 1 A ARG 0 ? A ARG 20 21 2 Y 1 A MET -19 ? A MET 1 22 2 Y 1 A GLY -18 ? A GLY 2 23 2 Y 1 A HIS -17 ? A HIS 3 24 2 Y 1 A HIS -16 ? A HIS 4 25 2 Y 1 A HIS -15 ? A HIS 5 26 2 Y 1 A HIS -14 ? A HIS 6 27 2 Y 1 A HIS -13 ? A HIS 7 28 2 Y 1 A HIS -12 ? A HIS 8 29 2 Y 1 A HIS -11 ? A HIS 9 30 2 Y 1 A HIS -10 ? A HIS 10 31 2 Y 1 A HIS -9 ? A HIS 11 32 2 Y 1 A HIS -8 ? A HIS 12 33 2 Y 1 A SER -7 ? A SER 13 34 2 Y 1 A SER -6 ? A SER 14 35 2 Y 1 A GLY -5 ? A GLY 15 36 2 Y 1 A HIS -4 ? A HIS 16 37 2 Y 1 A ILE -3 ? A ILE 17 38 2 Y 1 A GLU -2 ? A GLU 18 39 2 Y 1 A GLY -1 ? A GLY 19 40 2 Y 1 A ARG 0 ? A ARG 20 41 3 Y 1 A MET -19 ? A MET 1 42 3 Y 1 A GLY -18 ? A GLY 2 43 3 Y 1 A HIS -17 ? A HIS 3 44 3 Y 1 A HIS -16 ? A HIS 4 45 3 Y 1 A HIS -15 ? A HIS 5 46 3 Y 1 A HIS -14 ? A HIS 6 47 3 Y 1 A HIS -13 ? A HIS 7 48 3 Y 1 A HIS -12 ? A HIS 8 49 3 Y 1 A HIS -11 ? A HIS 9 50 3 Y 1 A HIS -10 ? A HIS 10 51 3 Y 1 A HIS -9 ? A HIS 11 52 3 Y 1 A HIS -8 ? A HIS 12 53 3 Y 1 A SER -7 ? A SER 13 54 3 Y 1 A SER -6 ? A SER 14 55 3 Y 1 A GLY -5 ? A GLY 15 56 3 Y 1 A HIS -4 ? A HIS 16 57 3 Y 1 A ILE -3 ? A ILE 17 58 3 Y 1 A GLU -2 ? A GLU 18 59 3 Y 1 A GLY -1 ? A GLY 19 60 3 Y 1 A ARG 0 ? A ARG 20 61 4 Y 1 A MET -19 ? A MET 1 62 4 Y 1 A GLY -18 ? A GLY 2 63 4 Y 1 A HIS -17 ? A HIS 3 64 4 Y 1 A HIS -16 ? A HIS 4 65 4 Y 1 A HIS -15 ? A HIS 5 66 4 Y 1 A HIS -14 ? A HIS 6 67 4 Y 1 A HIS -13 ? A HIS 7 68 4 Y 1 A HIS -12 ? A HIS 8 69 4 Y 1 A HIS -11 ? A HIS 9 70 4 Y 1 A HIS -10 ? A HIS 10 71 4 Y 1 A HIS -9 ? A HIS 11 72 4 Y 1 A HIS -8 ? A HIS 12 73 4 Y 1 A SER -7 ? A SER 13 74 4 Y 1 A SER -6 ? A SER 14 75 4 Y 1 A GLY -5 ? A GLY 15 76 4 Y 1 A HIS -4 ? A HIS 16 77 4 Y 1 A ILE -3 ? A ILE 17 78 4 Y 1 A GLU -2 ? A GLU 18 79 4 Y 1 A GLY -1 ? A GLY 19 80 4 Y 1 A ARG 0 ? A ARG 20 81 5 Y 1 A MET -19 ? A MET 1 82 5 Y 1 A GLY -18 ? A GLY 2 83 5 Y 1 A HIS -17 ? A HIS 3 84 5 Y 1 A HIS -16 ? A HIS 4 85 5 Y 1 A HIS -15 ? A HIS 5 86 5 Y 1 A HIS -14 ? A HIS 6 87 5 Y 1 A HIS -13 ? A HIS 7 88 5 Y 1 A HIS -12 ? A HIS 8 89 5 Y 1 A HIS -11 ? A HIS 9 90 5 Y 1 A HIS -10 ? A HIS 10 91 5 Y 1 A HIS -9 ? A HIS 11 92 5 Y 1 A HIS -8 ? A HIS 12 93 5 Y 1 A SER -7 ? A SER 13 94 5 Y 1 A SER -6 ? A SER 14 95 5 Y 1 A GLY -5 ? A GLY 15 96 5 Y 1 A HIS -4 ? A HIS 16 97 5 Y 1 A ILE -3 ? A ILE 17 98 5 Y 1 A GLU -2 ? A GLU 18 99 5 Y 1 A GLY -1 ? A GLY 19 100 5 Y 1 A ARG 0 ? A ARG 20 101 6 Y 1 A MET -19 ? A MET 1 102 6 Y 1 A GLY -18 ? A GLY 2 103 6 Y 1 A HIS -17 ? A HIS 3 104 6 Y 1 A HIS -16 ? A HIS 4 105 6 Y 1 A HIS -15 ? A HIS 5 106 6 Y 1 A HIS -14 ? A HIS 6 107 6 Y 1 A HIS -13 ? A HIS 7 108 6 Y 1 A HIS -12 ? A HIS 8 109 6 Y 1 A HIS -11 ? A HIS 9 110 6 Y 1 A HIS -10 ? A HIS 10 111 6 Y 1 A HIS -9 ? A HIS 11 112 6 Y 1 A HIS -8 ? A HIS 12 113 6 Y 1 A SER -7 ? A SER 13 114 6 Y 1 A SER -6 ? A SER 14 115 6 Y 1 A GLY -5 ? A GLY 15 116 6 Y 1 A HIS -4 ? A HIS 16 117 6 Y 1 A ILE -3 ? A ILE 17 118 6 Y 1 A GLU -2 ? A GLU 18 119 6 Y 1 A GLY -1 ? A GLY 19 120 6 Y 1 A ARG 0 ? A ARG 20 121 7 Y 1 A MET -19 ? A MET 1 122 7 Y 1 A GLY -18 ? A GLY 2 123 7 Y 1 A HIS -17 ? A HIS 3 124 7 Y 1 A HIS -16 ? A HIS 4 125 7 Y 1 A HIS -15 ? A HIS 5 126 7 Y 1 A HIS -14 ? A HIS 6 127 7 Y 1 A HIS -13 ? A HIS 7 128 7 Y 1 A HIS -12 ? A HIS 8 129 7 Y 1 A HIS -11 ? A HIS 9 130 7 Y 1 A HIS -10 ? A HIS 10 131 7 Y 1 A HIS -9 ? A HIS 11 132 7 Y 1 A HIS -8 ? A HIS 12 133 7 Y 1 A SER -7 ? A SER 13 134 7 Y 1 A SER -6 ? A SER 14 135 7 Y 1 A GLY -5 ? A GLY 15 136 7 Y 1 A HIS -4 ? A HIS 16 137 7 Y 1 A ILE -3 ? A ILE 17 138 7 Y 1 A GLU -2 ? A GLU 18 139 7 Y 1 A GLY -1 ? A GLY 19 140 7 Y 1 A ARG 0 ? A ARG 20 141 8 Y 1 A MET -19 ? A MET 1 142 8 Y 1 A GLY -18 ? A GLY 2 143 8 Y 1 A HIS -17 ? A HIS 3 144 8 Y 1 A HIS -16 ? A HIS 4 145 8 Y 1 A HIS -15 ? A HIS 5 146 8 Y 1 A HIS -14 ? A HIS 6 147 8 Y 1 A HIS -13 ? A HIS 7 148 8 Y 1 A HIS -12 ? A HIS 8 149 8 Y 1 A HIS -11 ? A HIS 9 150 8 Y 1 A HIS -10 ? A HIS 10 151 8 Y 1 A HIS -9 ? A HIS 11 152 8 Y 1 A HIS -8 ? A HIS 12 153 8 Y 1 A SER -7 ? A SER 13 154 8 Y 1 A SER -6 ? A SER 14 155 8 Y 1 A GLY -5 ? A GLY 15 156 8 Y 1 A HIS -4 ? A HIS 16 157 8 Y 1 A ILE -3 ? A ILE 17 158 8 Y 1 A GLU -2 ? A GLU 18 159 8 Y 1 A GLY -1 ? A GLY 19 160 8 Y 1 A ARG 0 ? A ARG 20 161 9 Y 1 A MET -19 ? A MET 1 162 9 Y 1 A GLY -18 ? A GLY 2 163 9 Y 1 A HIS -17 ? A HIS 3 164 9 Y 1 A HIS -16 ? A HIS 4 165 9 Y 1 A HIS -15 ? A HIS 5 166 9 Y 1 A HIS -14 ? A HIS 6 167 9 Y 1 A HIS -13 ? A HIS 7 168 9 Y 1 A HIS -12 ? A HIS 8 169 9 Y 1 A HIS -11 ? A HIS 9 170 9 Y 1 A HIS -10 ? A HIS 10 171 9 Y 1 A HIS -9 ? A HIS 11 172 9 Y 1 A HIS -8 ? A HIS 12 173 9 Y 1 A SER -7 ? A SER 13 174 9 Y 1 A SER -6 ? A SER 14 175 9 Y 1 A GLY -5 ? A GLY 15 176 9 Y 1 A HIS -4 ? A HIS 16 177 9 Y 1 A ILE -3 ? A ILE 17 178 9 Y 1 A GLU -2 ? A GLU 18 179 9 Y 1 A GLY -1 ? A GLY 19 180 9 Y 1 A ARG 0 ? A ARG 20 181 10 Y 1 A MET -19 ? A MET 1 182 10 Y 1 A GLY -18 ? A GLY 2 183 10 Y 1 A HIS -17 ? A HIS 3 184 10 Y 1 A HIS -16 ? A HIS 4 185 10 Y 1 A HIS -15 ? A HIS 5 186 10 Y 1 A HIS -14 ? A HIS 6 187 10 Y 1 A HIS -13 ? A HIS 7 188 10 Y 1 A HIS -12 ? A HIS 8 189 10 Y 1 A HIS -11 ? A HIS 9 190 10 Y 1 A HIS -10 ? A HIS 10 191 10 Y 1 A HIS -9 ? A HIS 11 192 10 Y 1 A HIS -8 ? A HIS 12 193 10 Y 1 A SER -7 ? A SER 13 194 10 Y 1 A SER -6 ? A SER 14 195 10 Y 1 A GLY -5 ? A GLY 15 196 10 Y 1 A HIS -4 ? A HIS 16 197 10 Y 1 A ILE -3 ? A ILE 17 198 10 Y 1 A GLU -2 ? A GLU 18 199 10 Y 1 A GLY -1 ? A GLY 19 200 10 Y 1 A ARG 0 ? A ARG 20 201 11 Y 1 A MET -19 ? A MET 1 202 11 Y 1 A GLY -18 ? A GLY 2 203 11 Y 1 A HIS -17 ? A HIS 3 204 11 Y 1 A HIS -16 ? A HIS 4 205 11 Y 1 A HIS -15 ? A HIS 5 206 11 Y 1 A HIS -14 ? A HIS 6 207 11 Y 1 A HIS -13 ? A HIS 7 208 11 Y 1 A HIS -12 ? A HIS 8 209 11 Y 1 A HIS -11 ? A HIS 9 210 11 Y 1 A HIS -10 ? A HIS 10 211 11 Y 1 A HIS -9 ? A HIS 11 212 11 Y 1 A HIS -8 ? A HIS 12 213 11 Y 1 A SER -7 ? A SER 13 214 11 Y 1 A SER -6 ? A SER 14 215 11 Y 1 A GLY -5 ? A GLY 15 216 11 Y 1 A HIS -4 ? A HIS 16 217 11 Y 1 A ILE -3 ? A ILE 17 218 11 Y 1 A GLU -2 ? A GLU 18 219 11 Y 1 A GLY -1 ? A GLY 19 220 11 Y 1 A ARG 0 ? A ARG 20 221 12 Y 1 A MET -19 ? A MET 1 222 12 Y 1 A GLY -18 ? A GLY 2 223 12 Y 1 A HIS -17 ? A HIS 3 224 12 Y 1 A HIS -16 ? A HIS 4 225 12 Y 1 A HIS -15 ? A HIS 5 226 12 Y 1 A HIS -14 ? A HIS 6 227 12 Y 1 A HIS -13 ? A HIS 7 228 12 Y 1 A HIS -12 ? A HIS 8 229 12 Y 1 A HIS -11 ? A HIS 9 230 12 Y 1 A HIS -10 ? A HIS 10 231 12 Y 1 A HIS -9 ? A HIS 11 232 12 Y 1 A HIS -8 ? A HIS 12 233 12 Y 1 A SER -7 ? A SER 13 234 12 Y 1 A SER -6 ? A SER 14 235 12 Y 1 A GLY -5 ? A GLY 15 236 12 Y 1 A HIS -4 ? A HIS 16 237 12 Y 1 A ILE -3 ? A ILE 17 238 12 Y 1 A GLU -2 ? A GLU 18 239 12 Y 1 A GLY -1 ? A GLY 19 240 12 Y 1 A ARG 0 ? A ARG 20 241 13 Y 1 A MET -19 ? A MET 1 242 13 Y 1 A GLY -18 ? A GLY 2 243 13 Y 1 A HIS -17 ? A HIS 3 244 13 Y 1 A HIS -16 ? A HIS 4 245 13 Y 1 A HIS -15 ? A HIS 5 246 13 Y 1 A HIS -14 ? A HIS 6 247 13 Y 1 A HIS -13 ? A HIS 7 248 13 Y 1 A HIS -12 ? A HIS 8 249 13 Y 1 A HIS -11 ? A HIS 9 250 13 Y 1 A HIS -10 ? A HIS 10 251 13 Y 1 A HIS -9 ? A HIS 11 252 13 Y 1 A HIS -8 ? A HIS 12 253 13 Y 1 A SER -7 ? A SER 13 254 13 Y 1 A SER -6 ? A SER 14 255 13 Y 1 A GLY -5 ? A GLY 15 256 13 Y 1 A HIS -4 ? A HIS 16 257 13 Y 1 A ILE -3 ? A ILE 17 258 13 Y 1 A GLU -2 ? A GLU 18 259 13 Y 1 A GLY -1 ? A GLY 19 260 13 Y 1 A ARG 0 ? A ARG 20 261 14 Y 1 A MET -19 ? A MET 1 262 14 Y 1 A GLY -18 ? A GLY 2 263 14 Y 1 A HIS -17 ? A HIS 3 264 14 Y 1 A HIS -16 ? A HIS 4 265 14 Y 1 A HIS -15 ? A HIS 5 266 14 Y 1 A HIS -14 ? A HIS 6 267 14 Y 1 A HIS -13 ? A HIS 7 268 14 Y 1 A HIS -12 ? A HIS 8 269 14 Y 1 A HIS -11 ? A HIS 9 270 14 Y 1 A HIS -10 ? A HIS 10 271 14 Y 1 A HIS -9 ? A HIS 11 272 14 Y 1 A HIS -8 ? A HIS 12 273 14 Y 1 A SER -7 ? A SER 13 274 14 Y 1 A SER -6 ? A SER 14 275 14 Y 1 A GLY -5 ? A GLY 15 276 14 Y 1 A HIS -4 ? A HIS 16 277 14 Y 1 A ILE -3 ? A ILE 17 278 14 Y 1 A GLU -2 ? A GLU 18 279 14 Y 1 A GLY -1 ? A GLY 19 280 14 Y 1 A ARG 0 ? A ARG 20 281 15 Y 1 A MET -19 ? A MET 1 282 15 Y 1 A GLY -18 ? A GLY 2 283 15 Y 1 A HIS -17 ? A HIS 3 284 15 Y 1 A HIS -16 ? A HIS 4 285 15 Y 1 A HIS -15 ? A HIS 5 286 15 Y 1 A HIS -14 ? A HIS 6 287 15 Y 1 A HIS -13 ? A HIS 7 288 15 Y 1 A HIS -12 ? A HIS 8 289 15 Y 1 A HIS -11 ? A HIS 9 290 15 Y 1 A HIS -10 ? A HIS 10 291 15 Y 1 A HIS -9 ? A HIS 11 292 15 Y 1 A HIS -8 ? A HIS 12 293 15 Y 1 A SER -7 ? A SER 13 294 15 Y 1 A SER -6 ? A SER 14 295 15 Y 1 A GLY -5 ? A GLY 15 296 15 Y 1 A HIS -4 ? A HIS 16 297 15 Y 1 A ILE -3 ? A ILE 17 298 15 Y 1 A GLU -2 ? A GLU 18 299 15 Y 1 A GLY -1 ? A GLY 19 300 15 Y 1 A ARG 0 ? A ARG 20 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TYR N N N N 287 TYR CA C N S 288 TYR C C N N 289 TYR O O N N 290 TYR CB C N N 291 TYR CG C Y N 292 TYR CD1 C Y N 293 TYR CD2 C Y N 294 TYR CE1 C Y N 295 TYR CE2 C Y N 296 TYR CZ C Y N 297 TYR OH O N N 298 TYR OXT O N N 299 TYR H H N N 300 TYR H2 H N N 301 TYR HA H N N 302 TYR HB2 H N N 303 TYR HB3 H N N 304 TYR HD1 H N N 305 TYR HD2 H N N 306 TYR HE1 H N N 307 TYR HE2 H N N 308 TYR HH H N N 309 TYR HXT H N N 310 VAL N N N N 311 VAL CA C N S 312 VAL C C N N 313 VAL O O N N 314 VAL CB C N N 315 VAL CG1 C N N 316 VAL CG2 C N N 317 VAL OXT O N N 318 VAL H H N N 319 VAL H2 H N N 320 VAL HA H N N 321 VAL HB H N N 322 VAL HG11 H N N 323 VAL HG12 H N N 324 VAL HG13 H N N 325 VAL HG21 H N N 326 VAL HG22 H N N 327 VAL HG23 H N N 328 VAL HXT H N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 ILE N CA sing N N 121 ILE N H sing N N 122 ILE N H2 sing N N 123 ILE CA C sing N N 124 ILE CA CB sing N N 125 ILE CA HA sing N N 126 ILE C O doub N N 127 ILE C OXT sing N N 128 ILE CB CG1 sing N N 129 ILE CB CG2 sing N N 130 ILE CB HB sing N N 131 ILE CG1 CD1 sing N N 132 ILE CG1 HG12 sing N N 133 ILE CG1 HG13 sing N N 134 ILE CG2 HG21 sing N N 135 ILE CG2 HG22 sing N N 136 ILE CG2 HG23 sing N N 137 ILE CD1 HD11 sing N N 138 ILE CD1 HD12 sing N N 139 ILE CD1 HD13 sing N N 140 ILE OXT HXT sing N N 141 LEU N CA sing N N 142 LEU N H sing N N 143 LEU N H2 sing N N 144 LEU CA C sing N N 145 LEU CA CB sing N N 146 LEU CA HA sing N N 147 LEU C O doub N N 148 LEU C OXT sing N N 149 LEU CB CG sing N N 150 LEU CB HB2 sing N N 151 LEU CB HB3 sing N N 152 LEU CG CD1 sing N N 153 LEU CG CD2 sing N N 154 LEU CG HG sing N N 155 LEU CD1 HD11 sing N N 156 LEU CD1 HD12 sing N N 157 LEU CD1 HD13 sing N N 158 LEU CD2 HD21 sing N N 159 LEU CD2 HD22 sing N N 160 LEU CD2 HD23 sing N N 161 LEU OXT HXT sing N N 162 LYS N CA sing N N 163 LYS N H sing N N 164 LYS N H2 sing N N 165 LYS CA C sing N N 166 LYS CA CB sing N N 167 LYS CA HA sing N N 168 LYS C O doub N N 169 LYS C OXT sing N N 170 LYS CB CG sing N N 171 LYS CB HB2 sing N N 172 LYS CB HB3 sing N N 173 LYS CG CD sing N N 174 LYS CG HG2 sing N N 175 LYS CG HG3 sing N N 176 LYS CD CE sing N N 177 LYS CD HD2 sing N N 178 LYS CD HD3 sing N N 179 LYS CE NZ sing N N 180 LYS CE HE2 sing N N 181 LYS CE HE3 sing N N 182 LYS NZ HZ1 sing N N 183 LYS NZ HZ2 sing N N 184 LYS NZ HZ3 sing N N 185 LYS OXT HXT sing N N 186 MET N CA sing N N 187 MET N H sing N N 188 MET N H2 sing N N 189 MET CA C sing N N 190 MET CA CB sing N N 191 MET CA HA sing N N 192 MET C O doub N N 193 MET C OXT sing N N 194 MET CB CG sing N N 195 MET CB HB2 sing N N 196 MET CB HB3 sing N N 197 MET CG SD sing N N 198 MET CG HG2 sing N N 199 MET CG HG3 sing N N 200 MET SD CE sing N N 201 MET CE HE1 sing N N 202 MET CE HE2 sing N N 203 MET CE HE3 sing N N 204 MET OXT HXT sing N N 205 PHE N CA sing N N 206 PHE N H sing N N 207 PHE N H2 sing N N 208 PHE CA C sing N N 209 PHE CA CB sing N N 210 PHE CA HA sing N N 211 PHE C O doub N N 212 PHE C OXT sing N N 213 PHE CB CG sing N N 214 PHE CB HB2 sing N N 215 PHE CB HB3 sing N N 216 PHE CG CD1 doub Y N 217 PHE CG CD2 sing Y N 218 PHE CD1 CE1 sing Y N 219 PHE CD1 HD1 sing N N 220 PHE CD2 CE2 doub Y N 221 PHE CD2 HD2 sing N N 222 PHE CE1 CZ doub Y N 223 PHE CE1 HE1 sing N N 224 PHE CE2 CZ sing Y N 225 PHE CE2 HE2 sing N N 226 PHE CZ HZ sing N N 227 PHE OXT HXT sing N N 228 PRO N CA sing N N 229 PRO N CD sing N N 230 PRO N H sing N N 231 PRO CA C sing N N 232 PRO CA CB sing N N 233 PRO CA HA sing N N 234 PRO C O doub N N 235 PRO C OXT sing N N 236 PRO CB CG sing N N 237 PRO CB HB2 sing N N 238 PRO CB HB3 sing N N 239 PRO CG CD sing N N 240 PRO CG HG2 sing N N 241 PRO CG HG3 sing N N 242 PRO CD HD2 sing N N 243 PRO CD HD3 sing N N 244 PRO OXT HXT sing N N 245 SER N CA sing N N 246 SER N H sing N N 247 SER N H2 sing N N 248 SER CA C sing N N 249 SER CA CB sing N N 250 SER CA HA sing N N 251 SER C O doub N N 252 SER C OXT sing N N 253 SER CB OG sing N N 254 SER CB HB2 sing N N 255 SER CB HB3 sing N N 256 SER OG HG sing N N 257 SER OXT HXT sing N N 258 THR N CA sing N N 259 THR N H sing N N 260 THR N H2 sing N N 261 THR CA C sing N N 262 THR CA CB sing N N 263 THR CA HA sing N N 264 THR C O doub N N 265 THR C OXT sing N N 266 THR CB OG1 sing N N 267 THR CB CG2 sing N N 268 THR CB HB sing N N 269 THR OG1 HG1 sing N N 270 THR CG2 HG21 sing N N 271 THR CG2 HG22 sing N N 272 THR CG2 HG23 sing N N 273 THR OXT HXT sing N N 274 TYR N CA sing N N 275 TYR N H sing N N 276 TYR N H2 sing N N 277 TYR CA C sing N N 278 TYR CA CB sing N N 279 TYR CA HA sing N N 280 TYR C O doub N N 281 TYR C OXT sing N N 282 TYR CB CG sing N N 283 TYR CB HB2 sing N N 284 TYR CB HB3 sing N N 285 TYR CG CD1 doub Y N 286 TYR CG CD2 sing Y N 287 TYR CD1 CE1 sing Y N 288 TYR CD1 HD1 sing N N 289 TYR CD2 CE2 doub Y N 290 TYR CD2 HD2 sing N N 291 TYR CE1 CZ doub Y N 292 TYR CE1 HE1 sing N N 293 TYR CE2 CZ sing Y N 294 TYR CE2 HE2 sing N N 295 TYR CZ OH sing N N 296 TYR OH HH sing N N 297 TYR OXT HXT sing N N 298 VAL N CA sing N N 299 VAL N H sing N N 300 VAL N H2 sing N N 301 VAL CA C sing N N 302 VAL CA CB sing N N 303 VAL CA HA sing N N 304 VAL C O doub N N 305 VAL C OXT sing N N 306 VAL CB CG1 sing N N 307 VAL CB CG2 sing N N 308 VAL CB HB sing N N 309 VAL CG1 HG11 sing N N 310 VAL CG1 HG12 sing N N 311 VAL CG1 HG13 sing N N 312 VAL CG2 HG21 sing N N 313 VAL CG2 HG22 sing N N 314 VAL CG2 HG23 sing N N 315 VAL OXT HXT sing N N 316 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 800 ? 2 INOVA Varian 600 ? # _atom_sites.entry_id 1YX4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_