data_1Z2E # _entry.id 1Z2E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Z2E pdb_00001z2e 10.2210/pdb1z2e/pdb RCSB RCSB032211 ? ? WWPDB D_1000032211 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1JL3 Oxidoreductase unspecified PDB 1Z2D 'the same protein in reduced state' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Z2E _pdbx_database_status.recvd_initial_deposition_date 2005-03-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jin, C.' 1 'Li, Y.' 2 # _citation.id primary _citation.title ;Solution Structures and Backbone Dynamics of Arsenate Reductase from Bacillus subtilis: REVERSIBLE CONFORMATIONAL SWITCH ASSOCIATED WITH ARSENATE REDUCTION ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 280 _citation.page_first 39601 _citation.page_last 39608 _citation.year 2005 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16192272 _citation.pdbx_database_id_DOI 10.1074/jbc.M508132200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guo, X.' 1 ? primary 'Li, Y.' 2 ? primary 'Peng, K.' 3 ? primary 'Hu, Y.' 4 ? primary 'Li, C.' 5 ? primary 'Xia, B.' 6 ? primary 'Jin, C.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Arsenate reductase' _entity.formula_weight 15614.480 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 1.20.4.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Arsenical pump modifier' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVT LCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK ; _entity_poly.pdbx_seq_one_letter_code_can ;MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVT LCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ASN n 1 4 LYS n 1 5 ILE n 1 6 ILE n 1 7 TYR n 1 8 PHE n 1 9 LEU n 1 10 CYS n 1 11 THR n 1 12 GLY n 1 13 ASN n 1 14 SER n 1 15 CYS n 1 16 ARG n 1 17 SER n 1 18 GLN n 1 19 MET n 1 20 ALA n 1 21 GLU n 1 22 GLY n 1 23 TRP n 1 24 ALA n 1 25 LYS n 1 26 GLN n 1 27 TYR n 1 28 LEU n 1 29 GLY n 1 30 ASP n 1 31 GLU n 1 32 TRP n 1 33 LYS n 1 34 VAL n 1 35 TYR n 1 36 SER n 1 37 ALA n 1 38 GLY n 1 39 ILE n 1 40 GLU n 1 41 ALA n 1 42 HIS n 1 43 GLY n 1 44 LEU n 1 45 ASN n 1 46 PRO n 1 47 ASN n 1 48 ALA n 1 49 VAL n 1 50 LYS n 1 51 ALA n 1 52 MET n 1 53 LYS n 1 54 GLU n 1 55 VAL n 1 56 GLY n 1 57 ILE n 1 58 ASP n 1 59 ILE n 1 60 SER n 1 61 ASN n 1 62 GLN n 1 63 THR n 1 64 SER n 1 65 ASP n 1 66 ILE n 1 67 ILE n 1 68 ASP n 1 69 SER n 1 70 ASP n 1 71 ILE n 1 72 LEU n 1 73 ASN n 1 74 ASN n 1 75 ALA n 1 76 ASP n 1 77 LEU n 1 78 VAL n 1 79 VAL n 1 80 THR n 1 81 LEU n 1 82 CYS n 1 83 GLY n 1 84 ASP n 1 85 ALA n 1 86 ALA n 1 87 ASP n 1 88 LYS n 1 89 CYS n 1 90 PRO n 1 91 MET n 1 92 THR n 1 93 PRO n 1 94 PRO n 1 95 HIS n 1 96 VAL n 1 97 LYS n 1 98 ARG n 1 99 GLU n 1 100 HIS n 1 101 TRP n 1 102 GLY n 1 103 PHE n 1 104 ASP n 1 105 ASP n 1 106 PRO n 1 107 ALA n 1 108 ARG n 1 109 ALA n 1 110 GLN n 1 111 GLY n 1 112 THR n 1 113 GLU n 1 114 GLU n 1 115 GLU n 1 116 LYS n 1 117 TRP n 1 118 ALA n 1 119 PHE n 1 120 PHE n 1 121 GLN n 1 122 ARG n 1 123 VAL n 1 124 ARG n 1 125 ASP n 1 126 GLU n 1 127 ILE n 1 128 GLY n 1 129 ASN n 1 130 ARG n 1 131 LEU n 1 132 LYS n 1 133 GLU n 1 134 PHE n 1 135 ALA n 1 136 GLU n 1 137 THR n 1 138 GLY n 1 139 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ARSC_BACSU _struct_ref.pdbx_db_accession P45947 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVT LCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Z2E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45947 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 139 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 HNHA 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.85 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '4mM ArsC U-15N, 13C; 20mM Tris buffer; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 800 ? 2 AVANCE Bruker 500 ? # _pdbx_nmr_refine.entry_id 1Z2E _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1Z2E _pdbx_nmr_details.text 'This structure was determined using standard 3D heteronuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1Z2E _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1Z2E _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 2.1 'Frank Delaglio' 2 'data analysis' NMRView 5 'Bruce Johnson' 3 'structure solution' CYANA 1.0.6 'Peter Gunter' 4 refinement Amber 7.0 'David Case' 5 # _exptl.entry_id 1Z2E _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1Z2E _struct.title 'Solution Structure of Bacillus subtilis ArsC in oxidized state' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Z2E _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'Bacillus subtilis, Arsenate Reductase, solution structure, structural genomics, Oxidoreductase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 15 ? LEU A 28 ? CYS A 15 LEU A 28 1 ? 14 HELX_P HELX_P2 2 ASN A 45 ? GLU A 54 ? ASN A 45 GLU A 54 1 ? 10 HELX_P HELX_P3 3 ASP A 68 ? ASN A 73 ? ASP A 68 ASN A 73 1 ? 6 HELX_P HELX_P4 4 ASP A 105 ? ALA A 109 ? ASP A 105 ALA A 109 5 ? 5 HELX_P HELX_P5 5 THR A 112 ? THR A 137 ? THR A 112 THR A 137 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 82 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 89 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 82 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 89 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.043 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 32 ? GLY A 38 ? TRP A 32 GLY A 38 A 2 LYS A 4 ? CYS A 10 ? LYS A 4 CYS A 10 A 3 LEU A 77 ? CYS A 82 ? LEU A 77 CYS A 82 A 4 ARG A 98 ? PHE A 103 ? ARG A 98 PHE A 103 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 33 ? O LYS A 33 N LYS A 4 ? N LYS A 4 A 2 3 N LEU A 9 ? N LEU A 9 O VAL A 79 ? O VAL A 79 A 3 4 N THR A 80 ? N THR A 80 O TRP A 101 ? O TRP A 101 # _database_PDB_matrix.entry_id 1Z2E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1Z2E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 TRP 117 117 117 TRP TRP A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LYS 139 139 139 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-10-04 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.58 2 1 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.59 3 2 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.58 4 3 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.59 5 5 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.57 6 5 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.59 7 6 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.58 8 6 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.60 9 7 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.59 10 8 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.60 11 9 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.58 12 9 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.59 13 10 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.59 14 11 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.59 15 12 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.57 16 12 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.60 17 13 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.57 18 13 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.60 19 14 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.58 20 15 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.57 21 15 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.59 22 16 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.58 23 17 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.57 24 18 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.59 25 18 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.59 26 19 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.59 27 19 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.60 28 20 OE1 A GLU 21 ? ? HG A SER 36 ? ? 1.57 29 20 OD1 A ASP 58 ? ? HG A SER 60 ? ? 1.59 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 116.72 121.00 -4.28 0.60 N 2 2 NE A ARG 130 ? ? CZ A ARG 130 ? ? NH2 A ARG 130 ? ? 117.11 120.30 -3.19 0.50 N 3 3 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.71 120.30 3.41 0.50 N 4 3 NE A ARG 130 ? ? CZ A ARG 130 ? ? NH1 A ARG 130 ? ? 123.31 120.30 3.01 0.50 N 5 5 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.01 120.30 -3.29 0.50 N 6 7 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 117.36 121.00 -3.64 0.60 N 7 7 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 116.65 120.30 -3.65 0.50 N 8 8 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 116.95 120.30 -3.35 0.50 N 9 9 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 117.04 121.00 -3.96 0.60 N 10 11 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.05 120.30 -3.25 0.50 N 11 12 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 117.36 121.00 -3.64 0.60 N 12 12 NE A ARG 130 ? ? CZ A ARG 130 ? ? NH2 A ARG 130 ? ? 116.93 120.30 -3.37 0.50 N 13 13 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.09 120.30 -3.21 0.50 N 14 17 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.09 120.30 -3.21 0.50 N 15 19 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH2 A ARG 16 ? ? 117.02 120.30 -3.28 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 15 ? ? -134.33 -93.81 2 1 ASP A 30 ? ? 58.69 8.45 3 1 LYS A 33 ? ? -67.62 97.30 4 1 ALA A 37 ? ? -160.89 -166.31 5 1 CYS A 89 ? ? 44.87 87.71 6 2 CYS A 15 ? ? -137.88 -87.12 7 2 ASP A 30 ? ? 57.14 14.32 8 2 LYS A 33 ? ? -67.54 97.42 9 2 ALA A 37 ? ? -161.34 -168.17 10 2 ASP A 87 ? ? 37.53 44.23 11 2 CYS A 89 ? ? 42.86 86.07 12 3 CYS A 15 ? ? -126.49 -99.45 13 3 ASP A 30 ? ? 57.56 5.80 14 3 LYS A 33 ? ? -68.92 97.86 15 3 CYS A 89 ? ? 60.51 95.58 16 4 CYS A 15 ? ? -131.68 -105.81 17 4 ASP A 30 ? ? 56.35 11.44 18 4 LYS A 33 ? ? -67.67 98.78 19 4 THR A 63 ? ? 56.07 176.76 20 4 CYS A 89 ? ? 53.56 122.62 21 4 TRP A 101 ? ? -119.90 58.10 22 5 CYS A 15 ? ? -136.30 -90.57 23 5 ASP A 30 ? ? 59.21 6.24 24 5 LYS A 33 ? ? -69.46 97.62 25 5 ALA A 37 ? ? -161.51 -166.85 26 5 THR A 63 ? ? 52.04 -173.24 27 5 CYS A 89 ? ? 43.37 90.27 28 5 ALA A 109 ? ? -58.71 95.67 29 6 ASN A 13 ? ? -82.80 45.72 30 6 CYS A 15 ? ? -145.91 -106.22 31 6 ALA A 37 ? ? -161.09 -168.04 32 6 ASP A 87 ? ? 33.17 56.77 33 6 CYS A 89 ? ? 44.05 94.63 34 6 TRP A 101 ? ? -116.40 55.54 35 7 CYS A 15 ? ? -128.86 -106.08 36 7 THR A 63 ? ? 51.20 -175.68 37 7 CYS A 89 ? ? 37.32 112.19 38 7 PHE A 103 ? ? -136.69 -100.37 39 8 THR A 11 ? ? -77.97 32.69 40 8 CYS A 15 ? ? -138.81 -90.40 41 8 ASP A 87 ? ? 46.44 28.83 42 8 CYS A 89 ? ? 54.69 109.88 43 9 CYS A 15 ? ? -137.98 -98.56 44 9 ASP A 30 ? ? 56.12 16.06 45 9 LYS A 33 ? ? -67.64 94.25 46 9 CYS A 82 ? ? -68.65 72.89 47 9 ASP A 87 ? ? 34.64 55.39 48 9 CYS A 89 ? ? 42.51 84.80 49 9 TRP A 101 ? ? -119.11 59.67 50 10 CYS A 15 ? ? -139.03 -90.93 51 10 LYS A 33 ? ? -67.64 99.70 52 10 ALA A 37 ? ? -160.05 -166.37 53 10 ASP A 87 ? ? 37.65 48.45 54 10 CYS A 89 ? ? 34.49 85.39 55 11 CYS A 15 ? ? -133.02 -94.67 56 11 ASP A 30 ? ? 58.88 11.60 57 11 ALA A 37 ? ? -162.96 -169.38 58 11 ASN A 61 ? ? -64.49 7.26 59 11 CYS A 89 ? ? 46.54 95.79 60 11 ALA A 109 ? ? -59.35 99.25 61 12 CYS A 15 ? ? -128.72 -87.59 62 12 ASP A 30 ? ? 57.78 9.61 63 12 LYS A 33 ? ? -67.79 97.54 64 12 ALA A 37 ? ? -161.57 -167.45 65 12 CYS A 89 ? ? 61.23 106.48 66 12 ALA A 109 ? ? -75.62 45.66 67 13 THR A 11 ? ? -76.08 35.23 68 13 CYS A 15 ? ? -137.10 -87.78 69 13 ASP A 30 ? ? 55.47 13.73 70 13 LYS A 33 ? ? -67.44 89.35 71 13 CYS A 89 ? ? 45.41 92.59 72 14 CYS A 15 ? ? -133.01 -96.99 73 14 ALA A 37 ? ? -160.05 -166.55 74 14 ASP A 87 ? ? 36.76 47.66 75 14 CYS A 89 ? ? 44.63 88.56 76 15 CYS A 15 ? ? -140.23 -101.98 77 15 ASP A 30 ? ? 55.80 9.44 78 15 LYS A 33 ? ? -68.70 88.55 79 15 THR A 63 ? ? 49.01 -164.71 80 15 CYS A 89 ? ? 35.96 88.51 81 15 ALA A 109 ? ? -61.21 93.24 82 16 CYS A 15 ? ? -137.85 -88.39 83 16 ASP A 30 ? ? 57.87 9.93 84 16 ALA A 37 ? ? -161.68 -167.31 85 16 CYS A 89 ? ? 41.53 110.65 86 17 THR A 11 ? ? -76.03 35.81 87 17 CYS A 15 ? ? -136.32 -89.61 88 17 ALA A 37 ? ? -162.53 -166.64 89 17 CYS A 89 ? ? 44.18 96.70 90 18 GLU A 2 ? ? -141.89 10.17 91 18 CYS A 15 ? ? -131.84 -106.33 92 18 ALA A 37 ? ? -163.16 -168.03 93 18 CYS A 89 ? ? 76.50 123.29 94 19 THR A 11 ? ? -76.82 34.21 95 19 CYS A 15 ? ? -136.32 -92.85 96 19 ALA A 37 ? ? -163.41 -166.62 97 19 CYS A 89 ? ? 47.32 94.36 98 20 CYS A 15 ? ? -138.38 -95.60 99 20 LYS A 33 ? ? -69.20 97.29 100 20 ALA A 37 ? ? -160.50 -166.97 101 20 CYS A 89 ? ? 34.93 88.05 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 7 ? ? 0.103 'SIDE CHAIN' 2 1 ARG A 98 ? ? 0.087 'SIDE CHAIN' 3 1 ARG A 130 ? ? 0.088 'SIDE CHAIN' 4 2 TYR A 7 ? ? 0.092 'SIDE CHAIN' 5 3 TYR A 7 ? ? 0.093 'SIDE CHAIN' 6 3 ARG A 98 ? ? 0.081 'SIDE CHAIN' 7 4 TYR A 7 ? ? 0.100 'SIDE CHAIN' 8 5 TYR A 7 ? ? 0.088 'SIDE CHAIN' 9 5 ARG A 98 ? ? 0.089 'SIDE CHAIN' 10 6 TYR A 7 ? ? 0.085 'SIDE CHAIN' 11 7 TYR A 7 ? ? 0.086 'SIDE CHAIN' 12 8 TYR A 7 ? ? 0.092 'SIDE CHAIN' 13 8 ARG A 98 ? ? 0.082 'SIDE CHAIN' 14 9 TYR A 7 ? ? 0.075 'SIDE CHAIN' 15 10 TYR A 7 ? ? 0.098 'SIDE CHAIN' 16 11 TYR A 7 ? ? 0.078 'SIDE CHAIN' 17 11 ARG A 98 ? ? 0.088 'SIDE CHAIN' 18 12 TYR A 7 ? ? 0.102 'SIDE CHAIN' 19 12 ARG A 98 ? ? 0.080 'SIDE CHAIN' 20 12 ARG A 108 ? ? 0.082 'SIDE CHAIN' 21 13 TYR A 7 ? ? 0.074 'SIDE CHAIN' 22 13 ARG A 98 ? ? 0.087 'SIDE CHAIN' 23 14 TYR A 7 ? ? 0.102 'SIDE CHAIN' 24 14 ARG A 98 ? ? 0.090 'SIDE CHAIN' 25 15 TYR A 7 ? ? 0.098 'SIDE CHAIN' 26 15 ARG A 98 ? ? 0.094 'SIDE CHAIN' 27 15 ARG A 130 ? ? 0.089 'SIDE CHAIN' 28 16 TYR A 7 ? ? 0.080 'SIDE CHAIN' 29 16 ARG A 98 ? ? 0.079 'SIDE CHAIN' 30 17 TYR A 7 ? ? 0.092 'SIDE CHAIN' 31 17 ARG A 98 ? ? 0.080 'SIDE CHAIN' 32 18 TYR A 7 ? ? 0.088 'SIDE CHAIN' 33 19 TYR A 7 ? ? 0.088 'SIDE CHAIN' 34 19 ARG A 98 ? ? 0.089 'SIDE CHAIN' 35 20 TYR A 7 ? ? 0.094 'SIDE CHAIN' #