data_1Z3J # _entry.id 1Z3J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Z3J pdb_00001z3j 10.2210/pdb1z3j/pdb RCSB RCSB032252 ? ? WWPDB D_1000032252 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1YCM _pdbx_database_related.details 'same structure, 20 models ensemble' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Z3J _pdbx_database_status.recvd_initial_deposition_date 2005-03-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry N _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bertini, I.' 1 'Calderone, V.' 2 'Cosenza, M.' 3 'Fragai, M.' 4 'Lee, Y.M.' 5 'Luchinat, C.' 6 'Mangani, S.' 7 'Terni, B.' 8 'Turano, P.' 9 # _citation.id primary _citation.title 'Conformational variability of matrix metalloproteinases: Beyond a single 3D structure.' _citation.journal_abbrev Proc.Natl.Acad.Sci.Usa _citation.journal_volume 102 _citation.page_first 5334 _citation.page_last 5339 _citation.year 2005 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15809432 _citation.pdbx_database_id_DOI 10.1073/pnas.0407106102 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bertini, I.' 1 ? primary 'Calderone, V.' 2 ? primary 'Cosenza, M.' 3 ? primary 'Fragai, M.' 4 ? primary 'Lee, Y.M.' 5 ? primary 'Luchinat, C.' 6 ? primary 'Mangani, S.' 7 ? primary 'Terni, B.' 8 ? primary 'Turano, P.' 9 ? # _cell.entry_id 1Z3J _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1Z3J _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Macrophage metalloelastase' 17615.670 1 3.4.24.65 F171D 'residues 106-263' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? 4 non-polymer syn 'N-ISOBUTYL-N-[4-METHOXYPHENYLSULFONYL]GLYCYL HYDROXAMIC ACID' 316.373 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HME, Matrix metalloproteinase-12, MMP-12, Macrophage elastase, ME' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHA FGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHA FGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 PRO n 1 4 VAL n 1 5 TRP n 1 6 ARG n 1 7 LYS n 1 8 HIS n 1 9 TYR n 1 10 ILE n 1 11 THR n 1 12 TYR n 1 13 ARG n 1 14 ILE n 1 15 ASN n 1 16 ASN n 1 17 TYR n 1 18 THR n 1 19 PRO n 1 20 ASP n 1 21 MET n 1 22 ASN n 1 23 ARG n 1 24 GLU n 1 25 ASP n 1 26 VAL n 1 27 ASP n 1 28 TYR n 1 29 ALA n 1 30 ILE n 1 31 ARG n 1 32 LYS n 1 33 ALA n 1 34 PHE n 1 35 GLN n 1 36 VAL n 1 37 TRP n 1 38 SER n 1 39 ASN n 1 40 VAL n 1 41 THR n 1 42 PRO n 1 43 LEU n 1 44 LYS n 1 45 PHE n 1 46 SER n 1 47 LYS n 1 48 ILE n 1 49 ASN n 1 50 THR n 1 51 GLY n 1 52 MET n 1 53 ALA n 1 54 ASP n 1 55 ILE n 1 56 LEU n 1 57 VAL n 1 58 VAL n 1 59 PHE n 1 60 ALA n 1 61 ARG n 1 62 GLY n 1 63 ALA n 1 64 HIS n 1 65 GLY n 1 66 ASP n 1 67 ASP n 1 68 HIS n 1 69 ALA n 1 70 PHE n 1 71 ASP n 1 72 GLY n 1 73 LYS n 1 74 GLY n 1 75 GLY n 1 76 ILE n 1 77 LEU n 1 78 ALA n 1 79 HIS n 1 80 ALA n 1 81 PHE n 1 82 GLY n 1 83 PRO n 1 84 GLY n 1 85 SER n 1 86 GLY n 1 87 ILE n 1 88 GLY n 1 89 GLY n 1 90 ASP n 1 91 ALA n 1 92 HIS n 1 93 PHE n 1 94 ASP n 1 95 GLU n 1 96 ASP n 1 97 GLU n 1 98 PHE n 1 99 TRP n 1 100 THR n 1 101 THR n 1 102 HIS n 1 103 SER n 1 104 GLY n 1 105 GLY n 1 106 THR n 1 107 ASN n 1 108 LEU n 1 109 PHE n 1 110 LEU n 1 111 THR n 1 112 ALA n 1 113 VAL n 1 114 HIS n 1 115 GLU n 1 116 ILE n 1 117 GLY n 1 118 HIS n 1 119 SER n 1 120 LEU n 1 121 GLY n 1 122 LEU n 1 123 GLY n 1 124 HIS n 1 125 SER n 1 126 SER n 1 127 ASP n 1 128 PRO n 1 129 LYS n 1 130 ALA n 1 131 VAL n 1 132 MET n 1 133 PHE n 1 134 PRO n 1 135 THR n 1 136 TYR n 1 137 LYS n 1 138 TYR n 1 139 VAL n 1 140 ASP n 1 141 ILE n 1 142 ASN n 1 143 THR n 1 144 PHE n 1 145 ARG n 1 146 LEU n 1 147 SER n 1 148 ALA n 1 149 ASP n 1 150 ASP n 1 151 ILE n 1 152 ARG n 1 153 GLY n 1 154 ILE n 1 155 GLN n 1 156 SER n 1 157 LEU n 1 158 TYR n 1 159 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET21 (Novagen)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MMP12_HUMAN _struct_ref.pdbx_db_accession P39900 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAF GPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG ; _struct_ref.pdbx_align_begin 106 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Z3J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 159 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P39900 _struct_ref_seq.db_align_beg 106 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 263 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 106 _struct_ref_seq.pdbx_auth_seq_align_end 263 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1Z3J MET A 1 ? UNP P39900 ? ? 'initiating methionine' 105 1 1 1Z3J ASP A 67 ? UNP P39900 PHE 171 'engineered mutation' 171 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NGH non-polymer . 'N-ISOBUTYL-N-[4-METHOXYPHENYLSULFONYL]GLYCYL HYDROXAMIC ACID' ? 'C13 H20 N2 O5 S' 316.373 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 '2D NOESY' 1 4 1 HNHA 1 5 1 'Isotope-Filtered 2D NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength '0.3 M NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.9 mM MMP12 U-15N,13C; 10mM deuterated Tris; 5 mM CaCl2; 0.1 mM ZnCl2; 0.3 M NaCl; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 900 ? 2 AVANCE Bruker 800 ? 3 AVANCE Bruker 700 ? 4 DRX Bruker 500 ? # _pdbx_nmr_refine.entry_id 1Z3J _pdbx_nmr_refine.method 'distance geometry, simulated annealing, torsion angle dynamics, residue dipolar coupling' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1Z3J _pdbx_nmr_details.text 'This structure was determined using distance, dihedral angle and H-bond restraints with dipolar coupling restraints' # _pdbx_nmr_ensemble.entry_id 1Z3J _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'minimized average structure' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1Z3J _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.1 BRUNGER 1 processing XwinNMR 3.1 BRUNGER 2 'data analysis' XEASY 1.3 Guntert 3 'structure solution' DYANA 1.5 Guntert 4 refinement Amber 6.0 ? 5 # _exptl.entry_id 1Z3J _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1Z3J _struct.title 'Solution Structure of MMP12 in the presence of N-isobutyl-N-4-methoxyphenylsulfonyl]glycyl hydroxamic acid (NNGH)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1Z3J _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'macrophage metalloelastase, MMP-12, solution structure, NNGH, zinc, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 22 ? THR A 41 ? ASN A 126 THR A 145 1 ? 20 HELX_P HELX_P2 2 LEU A 108 ? GLY A 121 ? LEU A 212 GLY A 225 1 ? 14 HELX_P HELX_P3 3 SER A 147 ? SER A 156 ? SER A 251 SER A 260 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 20 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 124 A CA 266 1_555 ? ? ? ? ? ? ? 2.266 ? ? metalc2 metalc ? ? A ASP 20 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 124 A CA 266 1_555 ? ? ? ? ? ? ? 2.530 ? ? metalc3 metalc ? ? A HIS 64 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 168 A ZN 265 1_555 ? ? ? ? ? ? ? 2.324 ? ? metalc4 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 170 A ZN 265 1_555 ? ? ? ? ? ? ? 2.062 ? ? metalc5 metalc ? ? A ASP 66 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 170 A ZN 265 1_555 ? ? ? ? ? ? ? 2.198 ? ? metalc6 metalc ? ? A ASP 71 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 175 A CA 267 1_555 ? ? ? ? ? ? ? 3.987 ? ? metalc7 metalc ? ? A ASP 71 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 175 A CA 267 1_555 ? ? ? ? ? ? ? 2.232 ? ? metalc8 metalc ? ? A GLY 72 O ? ? ? 1_555 E CA . CA ? ? A GLY 176 A CA 267 1_555 ? ? ? ? ? ? ? 2.383 ? ? metalc9 metalc ? ? A GLY 74 O ? ? ? 1_555 E CA . CA ? ? A GLY 178 A CA 267 1_555 ? ? ? ? ? ? ? 2.375 ? ? metalc10 metalc ? ? A ILE 76 O ? ? ? 1_555 E CA . CA ? ? A ILE 180 A CA 267 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc11 metalc ? ? A HIS 79 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 183 A ZN 265 1_555 ? ? ? ? ? ? ? 2.212 ? ? metalc12 metalc ? ? A GLY 86 O ? ? ? 1_555 F CA . CA ? ? A GLY 190 A CA 268 1_555 ? ? ? ? ? ? ? 2.619 ? ? metalc13 metalc ? ? A ILE 87 O ? ? ? 1_555 F CA . CA ? ? A ILE 191 A CA 268 1_555 ? ? ? ? ? ? ? 2.990 ? ? metalc14 metalc ? ? A GLY 88 O ? ? ? 1_555 F CA . CA ? ? A GLY 192 A CA 268 1_555 ? ? ? ? ? ? ? 2.399 ? ? metalc15 metalc ? ? A ASP 90 OD2 ? ? ? 1_555 F CA . CA ? ? A ASP 194 A CA 268 1_555 ? ? ? ? ? ? ? 2.594 ? ? metalc16 metalc ? ? A ASP 90 OD1 ? ? ? 1_555 F CA . CA ? ? A ASP 194 A CA 268 1_555 ? ? ? ? ? ? ? 2.262 ? ? metalc17 metalc ? ? A HIS 92 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 196 A ZN 265 1_555 ? ? ? ? ? ? ? 2.261 ? ? metalc18 metalc ? ? A ASP 94 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 198 A CA 267 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc19 metalc ? ? A ASP 94 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 198 A CA 267 1_555 ? ? ? ? ? ? ? 2.417 ? ? metalc20 metalc ? ? A GLU 95 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 199 A CA 266 1_555 ? ? ? ? ? ? ? 2.261 ? ? metalc21 metalc ? ? A GLU 95 O ? ? ? 1_555 D CA . CA ? ? A GLU 199 A CA 266 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc22 metalc ? ? A GLU 97 O ? ? ? 1_555 D CA . CA ? ? A GLU 201 A CA 266 1_555 ? ? ? ? ? ? ? 2.487 ? ? metalc23 metalc ? ? A GLU 97 OE2 ? ? ? 1_555 E CA . CA ? ? A GLU 201 A CA 267 1_555 ? ? ? ? ? ? ? 2.241 ? ? metalc24 metalc ? ? A HIS 114 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 218 A ZN 264 1_555 ? ? ? ? ? ? ? 2.077 ? ? metalc25 metalc ? ? A HIS 118 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 222 A ZN 264 1_555 ? ? ? ? ? ? ? 2.080 ? ? metalc26 metalc ? ? A HIS 124 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 228 A ZN 264 1_555 ? ? ? ? ? ? ? 2.132 ? ? metalc27 metalc ? ? B ZN . ZN ? ? ? 1_555 G NGH . O4 ? ? A ZN 264 A NGH 269 1_555 ? ? ? ? ? ? ? 2.114 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MET 1 A . ? MET 105 A GLY 2 A ? GLY 106 A 1 5.82 2 PRO 3 A . ? PRO 107 A VAL 4 A ? VAL 108 A 1 -5.88 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel B 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 44 ? LYS A 47 ? LYS A 148 LYS A 151 A 2 TYR A 9 ? ILE A 14 ? TYR A 113 ILE A 118 A 3 ILE A 55 ? PHE A 59 ? ILE A 159 PHE A 163 A 4 ALA A 91 ? PHE A 93 ? ALA A 195 PHE A 197 A 5 ALA A 78 ? ALA A 80 ? ALA A 182 ALA A 184 B 1 TRP A 99 ? THR A 100 ? TRP A 203 THR A 204 B 2 THR A 106 ? ASN A 107 ? THR A 210 ASN A 211 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 46 ? O SER A 150 N ILE A 10 ? N ILE A 114 A 2 3 N ARG A 13 ? N ARG A 117 O VAL A 57 ? O VAL A 161 A 3 4 N VAL A 58 ? N VAL A 162 O PHE A 93 ? O PHE A 197 A 4 5 O HIS A 92 ? O HIS A 196 N HIS A 79 ? N HIS A 183 B 1 2 N THR A 100 ? N THR A 204 O THR A 106 ? O THR A 210 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 264 ? 4 'BINDING SITE FOR RESIDUE ZN A 264' AC2 Software A ZN 265 ? 4 'BINDING SITE FOR RESIDUE ZN A 265' AC3 Software A CA 266 ? 4 'BINDING SITE FOR RESIDUE CA A 266' AC4 Software A CA 267 ? 6 'BINDING SITE FOR RESIDUE CA A 267' AC5 Software A CA 268 ? 4 'BINDING SITE FOR RESIDUE CA A 268' AC6 Software A NGH 269 ? 13 'BINDING SITE FOR RESIDUE NGH A 269' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 114 ? HIS A 218 . ? 1_555 ? 2 AC1 4 HIS A 118 ? HIS A 222 . ? 1_555 ? 3 AC1 4 HIS A 124 ? HIS A 228 . ? 1_555 ? 4 AC1 4 NGH G . ? NGH A 269 . ? 1_555 ? 5 AC2 4 HIS A 64 ? HIS A 168 . ? 1_555 ? 6 AC2 4 ASP A 66 ? ASP A 170 . ? 1_555 ? 7 AC2 4 HIS A 79 ? HIS A 183 . ? 1_555 ? 8 AC2 4 HIS A 92 ? HIS A 196 . ? 1_555 ? 9 AC3 4 THR A 18 ? THR A 122 . ? 1_555 ? 10 AC3 4 ASP A 20 ? ASP A 124 . ? 1_555 ? 11 AC3 4 GLU A 95 ? GLU A 199 . ? 1_555 ? 12 AC3 4 GLU A 97 ? GLU A 201 . ? 1_555 ? 13 AC4 6 ASP A 71 ? ASP A 175 . ? 1_555 ? 14 AC4 6 GLY A 72 ? GLY A 176 . ? 1_555 ? 15 AC4 6 GLY A 74 ? GLY A 178 . ? 1_555 ? 16 AC4 6 ILE A 76 ? ILE A 180 . ? 1_555 ? 17 AC4 6 ASP A 94 ? ASP A 198 . ? 1_555 ? 18 AC4 6 GLU A 97 ? GLU A 201 . ? 1_555 ? 19 AC5 4 GLY A 86 ? GLY A 190 . ? 1_555 ? 20 AC5 4 ILE A 87 ? ILE A 191 . ? 1_555 ? 21 AC5 4 GLY A 88 ? GLY A 192 . ? 1_555 ? 22 AC5 4 ASP A 90 ? ASP A 194 . ? 1_555 ? 23 AC6 13 GLY A 75 ? GLY A 179 . ? 1_555 ? 24 AC6 13 ILE A 76 ? ILE A 180 . ? 1_555 ? 25 AC6 13 LEU A 77 ? LEU A 181 . ? 1_555 ? 26 AC6 13 ALA A 78 ? ALA A 182 . ? 1_555 ? 27 AC6 13 LEU A 110 ? LEU A 214 . ? 1_555 ? 28 AC6 13 THR A 111 ? THR A 215 . ? 1_555 ? 29 AC6 13 HIS A 114 ? HIS A 218 . ? 1_555 ? 30 AC6 13 GLU A 115 ? GLU A 219 . ? 1_555 ? 31 AC6 13 HIS A 118 ? HIS A 222 . ? 1_555 ? 32 AC6 13 PRO A 134 ? PRO A 238 . ? 1_555 ? 33 AC6 13 THR A 135 ? THR A 239 . ? 1_555 ? 34 AC6 13 TYR A 136 ? TYR A 240 . ? 1_555 ? 35 AC6 13 ZN B . ? ZN A 264 . ? 1_555 ? # _database_PDB_matrix.entry_id 1Z3J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1Z3J _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S ZN # loop_ _database_PDB_caveat.text 'Chirality errors at CA center of VAL 108 A' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 105 105 MET MET A . n A 1 2 GLY 2 106 106 GLY GLY A . n A 1 3 PRO 3 107 107 PRO PRO A . n A 1 4 VAL 4 108 108 VAL VAL A . n A 1 5 TRP 5 109 109 TRP TRP A . n A 1 6 ARG 6 110 110 ARG ARG A . n A 1 7 LYS 7 111 111 LYS LYS A . n A 1 8 HIS 8 112 112 HIS HIS A . n A 1 9 TYR 9 113 113 TYR TYR A . n A 1 10 ILE 10 114 114 ILE ILE A . n A 1 11 THR 11 115 115 THR THR A . n A 1 12 TYR 12 116 116 TYR TYR A . n A 1 13 ARG 13 117 117 ARG ARG A . n A 1 14 ILE 14 118 118 ILE ILE A . n A 1 15 ASN 15 119 119 ASN ASN A . n A 1 16 ASN 16 120 120 ASN ASN A . n A 1 17 TYR 17 121 121 TYR TYR A . n A 1 18 THR 18 122 122 THR THR A . n A 1 19 PRO 19 123 123 PRO PRO A . n A 1 20 ASP 20 124 124 ASP ASP A . n A 1 21 MET 21 125 125 MET MET A . n A 1 22 ASN 22 126 126 ASN ASN A . n A 1 23 ARG 23 127 127 ARG ARG A . n A 1 24 GLU 24 128 128 GLU GLU A . n A 1 25 ASP 25 129 129 ASP ASP A . n A 1 26 VAL 26 130 130 VAL VAL A . n A 1 27 ASP 27 131 131 ASP ASP A . n A 1 28 TYR 28 132 132 TYR TYR A . n A 1 29 ALA 29 133 133 ALA ALA A . n A 1 30 ILE 30 134 134 ILE ILE A . n A 1 31 ARG 31 135 135 ARG ARG A . n A 1 32 LYS 32 136 136 LYS LYS A . n A 1 33 ALA 33 137 137 ALA ALA A . n A 1 34 PHE 34 138 138 PHE PHE A . n A 1 35 GLN 35 139 139 GLN GLN A . n A 1 36 VAL 36 140 140 VAL VAL A . n A 1 37 TRP 37 141 141 TRP TRP A . n A 1 38 SER 38 142 142 SER SER A . n A 1 39 ASN 39 143 143 ASN ASN A . n A 1 40 VAL 40 144 144 VAL VAL A . n A 1 41 THR 41 145 145 THR THR A . n A 1 42 PRO 42 146 146 PRO PRO A . n A 1 43 LEU 43 147 147 LEU LEU A . n A 1 44 LYS 44 148 148 LYS LYS A . n A 1 45 PHE 45 149 149 PHE PHE A . n A 1 46 SER 46 150 150 SER SER A . n A 1 47 LYS 47 151 151 LYS LYS A . n A 1 48 ILE 48 152 152 ILE ILE A . n A 1 49 ASN 49 153 153 ASN ASN A . n A 1 50 THR 50 154 154 THR THR A . n A 1 51 GLY 51 155 155 GLY GLY A . n A 1 52 MET 52 156 156 MET MET A . n A 1 53 ALA 53 157 157 ALA ALA A . n A 1 54 ASP 54 158 158 ASP ASP A . n A 1 55 ILE 55 159 159 ILE ILE A . n A 1 56 LEU 56 160 160 LEU LEU A . n A 1 57 VAL 57 161 161 VAL VAL A . n A 1 58 VAL 58 162 162 VAL VAL A . n A 1 59 PHE 59 163 163 PHE PHE A . n A 1 60 ALA 60 164 164 ALA ALA A . n A 1 61 ARG 61 165 165 ARG ARG A . n A 1 62 GLY 62 166 166 GLY GLY A . n A 1 63 ALA 63 167 167 ALA ALA A . n A 1 64 HIS 64 168 168 HIS HIS A . n A 1 65 GLY 65 169 169 GLY GLY A . n A 1 66 ASP 66 170 170 ASP ASP A . n A 1 67 ASP 67 171 171 ASP ASP A . n A 1 68 HIS 68 172 172 HIS HIS A . n A 1 69 ALA 69 173 173 ALA ALA A . n A 1 70 PHE 70 174 174 PHE PHE A . n A 1 71 ASP 71 175 175 ASP ASP A . n A 1 72 GLY 72 176 176 GLY GLY A . n A 1 73 LYS 73 177 177 LYS LYS A . n A 1 74 GLY 74 178 178 GLY GLY A . n A 1 75 GLY 75 179 179 GLY GLY A . n A 1 76 ILE 76 180 180 ILE ILE A . n A 1 77 LEU 77 181 181 LEU LEU A . n A 1 78 ALA 78 182 182 ALA ALA A . n A 1 79 HIS 79 183 183 HIS HIS A . n A 1 80 ALA 80 184 184 ALA ALA A . n A 1 81 PHE 81 185 185 PHE PHE A . n A 1 82 GLY 82 186 186 GLY GLY A . n A 1 83 PRO 83 187 187 PRO PRO A . n A 1 84 GLY 84 188 188 GLY GLY A . n A 1 85 SER 85 189 189 SER SER A . n A 1 86 GLY 86 190 190 GLY GLY A . n A 1 87 ILE 87 191 191 ILE ILE A . n A 1 88 GLY 88 192 192 GLY GLY A . n A 1 89 GLY 89 193 193 GLY GLY A . n A 1 90 ASP 90 194 194 ASP ASP A . n A 1 91 ALA 91 195 195 ALA ALA A . n A 1 92 HIS 92 196 196 HIS HIS A . n A 1 93 PHE 93 197 197 PHE PHE A . n A 1 94 ASP 94 198 198 ASP ASP A . n A 1 95 GLU 95 199 199 GLU GLU A . n A 1 96 ASP 96 200 200 ASP ASP A . n A 1 97 GLU 97 201 201 GLU GLU A . n A 1 98 PHE 98 202 202 PHE PHE A . n A 1 99 TRP 99 203 203 TRP TRP A . n A 1 100 THR 100 204 204 THR THR A . n A 1 101 THR 101 205 205 THR THR A . n A 1 102 HIS 102 206 206 HIS HIS A . n A 1 103 SER 103 207 207 SER SER A . n A 1 104 GLY 104 208 208 GLY GLY A . n A 1 105 GLY 105 209 209 GLY GLY A . n A 1 106 THR 106 210 210 THR THR A . n A 1 107 ASN 107 211 211 ASN ASN A . n A 1 108 LEU 108 212 212 LEU LEU A . n A 1 109 PHE 109 213 213 PHE PHE A . n A 1 110 LEU 110 214 214 LEU LEU A . n A 1 111 THR 111 215 215 THR THR A . n A 1 112 ALA 112 216 216 ALA ALA A . n A 1 113 VAL 113 217 217 VAL VAL A . n A 1 114 HIS 114 218 218 HIS HIS A . n A 1 115 GLU 115 219 219 GLU GLU A . n A 1 116 ILE 116 220 220 ILE ILE A . n A 1 117 GLY 117 221 221 GLY GLY A . n A 1 118 HIS 118 222 222 HIS HIS A . n A 1 119 SER 119 223 223 SER SER A . n A 1 120 LEU 120 224 224 LEU LEU A . n A 1 121 GLY 121 225 225 GLY GLY A . n A 1 122 LEU 122 226 226 LEU LEU A . n A 1 123 GLY 123 227 227 GLY GLY A . n A 1 124 HIS 124 228 228 HIS HIS A . n A 1 125 SER 125 229 229 SER SER A . n A 1 126 SER 126 230 230 SER SER A . n A 1 127 ASP 127 231 231 ASP ASP A . n A 1 128 PRO 128 232 232 PRO PRO A . n A 1 129 LYS 129 233 233 LYS LYS A . n A 1 130 ALA 130 234 234 ALA ALA A . n A 1 131 VAL 131 235 235 VAL VAL A . n A 1 132 MET 132 236 236 MET MET A . n A 1 133 PHE 133 237 237 PHE PHE A . n A 1 134 PRO 134 238 238 PRO PRO A . n A 1 135 THR 135 239 239 THR THR A . n A 1 136 TYR 136 240 240 TYR TYR A . n A 1 137 LYS 137 241 241 LYS LYS A . n A 1 138 TYR 138 242 242 TYR TYR A . n A 1 139 VAL 139 243 243 VAL VAL A . n A 1 140 ASP 140 244 244 ASP ASP A . n A 1 141 ILE 141 245 245 ILE ILE A . n A 1 142 ASN 142 246 246 ASN ASN A . n A 1 143 THR 143 247 247 THR THR A . n A 1 144 PHE 144 248 248 PHE PHE A . n A 1 145 ARG 145 249 249 ARG ARG A . n A 1 146 LEU 146 250 250 LEU LEU A . n A 1 147 SER 147 251 251 SER SER A . n A 1 148 ALA 148 252 252 ALA ALA A . n A 1 149 ASP 149 253 253 ASP ASP A . n A 1 150 ASP 150 254 254 ASP ASP A . n A 1 151 ILE 151 255 255 ILE ILE A . n A 1 152 ARG 152 256 256 ARG ARG A . n A 1 153 GLY 153 257 257 GLY GLY A . n A 1 154 ILE 154 258 258 ILE ILE A . n A 1 155 GLN 155 259 259 GLN GLN A . n A 1 156 SER 156 260 260 SER SER A . n A 1 157 LEU 157 261 261 LEU LEU A . n A 1 158 TYR 158 262 262 TYR TYR A . n A 1 159 GLY 159 263 263 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 264 264 ZN ZN A . C 2 ZN 1 265 265 ZN ZN A . D 3 CA 1 266 266 CA CA A . E 3 CA 1 267 267 CA CA A . F 3 CA 1 268 268 CA CA A . G 4 NGH 1 269 269 NGH NGH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 20 ? A ASP 124 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 OD1 ? A ASP 20 ? A ASP 124 ? 1_555 52.4 ? 2 OD2 ? A ASP 20 ? A ASP 124 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 OE2 ? A GLU 95 ? A GLU 199 ? 1_555 130.7 ? 3 OD1 ? A ASP 20 ? A ASP 124 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 OE2 ? A GLU 95 ? A GLU 199 ? 1_555 78.6 ? 4 OD2 ? A ASP 20 ? A ASP 124 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 O ? A GLU 95 ? A GLU 199 ? 1_555 147.2 ? 5 OD1 ? A ASP 20 ? A ASP 124 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 O ? A GLU 95 ? A GLU 199 ? 1_555 137.1 ? 6 OE2 ? A GLU 95 ? A GLU 199 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 O ? A GLU 95 ? A GLU 199 ? 1_555 72.8 ? 7 OD2 ? A ASP 20 ? A ASP 124 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 O ? A GLU 97 ? A GLU 201 ? 1_555 81.2 ? 8 OD1 ? A ASP 20 ? A ASP 124 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 O ? A GLU 97 ? A GLU 201 ? 1_555 118.0 ? 9 OE2 ? A GLU 95 ? A GLU 199 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 O ? A GLU 97 ? A GLU 201 ? 1_555 134.4 ? 10 O ? A GLU 95 ? A GLU 199 ? 1_555 CA ? D CA . ? A CA 266 ? 1_555 O ? A GLU 97 ? A GLU 201 ? 1_555 67.2 ? 11 NE2 ? A HIS 64 ? A HIS 168 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 OD1 ? A ASP 66 ? A ASP 170 ? 1_555 84.1 ? 12 NE2 ? A HIS 64 ? A HIS 168 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 OD2 ? A ASP 66 ? A ASP 170 ? 1_555 143.6 ? 13 OD1 ? A ASP 66 ? A ASP 170 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 OD2 ? A ASP 66 ? A ASP 170 ? 1_555 59.5 ? 14 NE2 ? A HIS 64 ? A HIS 168 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 NE2 ? A HIS 79 ? A HIS 183 ? 1_555 107.2 ? 15 OD1 ? A ASP 66 ? A ASP 170 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 NE2 ? A HIS 79 ? A HIS 183 ? 1_555 114.8 ? 16 OD2 ? A ASP 66 ? A ASP 170 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 NE2 ? A HIS 79 ? A HIS 183 ? 1_555 89.6 ? 17 NE2 ? A HIS 64 ? A HIS 168 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 ND1 ? A HIS 92 ? A HIS 196 ? 1_555 95.3 ? 18 OD1 ? A ASP 66 ? A ASP 170 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 ND1 ? A HIS 92 ? A HIS 196 ? 1_555 158.7 ? 19 OD2 ? A ASP 66 ? A ASP 170 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 ND1 ? A HIS 92 ? A HIS 196 ? 1_555 118.5 ? 20 NE2 ? A HIS 79 ? A HIS 183 ? 1_555 ZN ? C ZN . ? A ZN 265 ? 1_555 ND1 ? A HIS 92 ? A HIS 196 ? 1_555 85.8 ? 21 OD2 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD1 ? A ASP 71 ? A ASP 175 ? 1_555 26.1 ? 22 OD2 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 O ? A GLY 72 ? A GLY 176 ? 1_555 101.8 ? 23 OD1 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 O ? A GLY 72 ? A GLY 176 ? 1_555 78.3 ? 24 OD2 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 O ? A GLY 74 ? A GLY 178 ? 1_555 63.3 ? 25 OD1 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 O ? A GLY 74 ? A GLY 178 ? 1_555 74.6 ? 26 O ? A GLY 72 ? A GLY 176 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 O ? A GLY 74 ? A GLY 178 ? 1_555 90.6 ? 27 OD2 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 O ? A ILE 76 ? A ILE 180 ? 1_555 70.8 ? 28 OD1 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 O ? A ILE 76 ? A ILE 180 ? 1_555 96.3 ? 29 O ? A GLY 72 ? A GLY 176 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 O ? A ILE 76 ? A ILE 180 ? 1_555 165.5 ? 30 O ? A GLY 74 ? A GLY 178 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 O ? A ILE 76 ? A ILE 180 ? 1_555 74.9 ? 31 OD2 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD1 ? A ASP 94 ? A ASP 198 ? 1_555 94.5 ? 32 OD1 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD1 ? A ASP 94 ? A ASP 198 ? 1_555 96.4 ? 33 O ? A GLY 72 ? A GLY 176 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD1 ? A ASP 94 ? A ASP 198 ? 1_555 119.5 ? 34 O ? A GLY 74 ? A GLY 178 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD1 ? A ASP 94 ? A ASP 198 ? 1_555 146.6 ? 35 O ? A ILE 76 ? A ILE 180 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD1 ? A ASP 94 ? A ASP 198 ? 1_555 74.2 ? 36 OD2 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD2 ? A ASP 94 ? A ASP 198 ? 1_555 138.2 ? 37 OD1 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD2 ? A ASP 94 ? A ASP 198 ? 1_555 121.6 ? 38 O ? A GLY 72 ? A GLY 176 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD2 ? A ASP 94 ? A ASP 198 ? 1_555 78.7 ? 39 O ? A GLY 74 ? A GLY 178 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD2 ? A ASP 94 ? A ASP 198 ? 1_555 157.4 ? 40 O ? A ILE 76 ? A ILE 180 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD2 ? A ASP 94 ? A ASP 198 ? 1_555 115.3 ? 41 OD1 ? A ASP 94 ? A ASP 198 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OD2 ? A ASP 94 ? A ASP 198 ? 1_555 53.1 ? 42 OD2 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OE2 ? A GLU 97 ? A GLU 201 ? 1_555 142.7 ? 43 OD1 ? A ASP 71 ? A ASP 175 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OE2 ? A GLU 97 ? A GLU 201 ? 1_555 143.2 ? 44 O ? A GLY 72 ? A GLY 176 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OE2 ? A GLU 97 ? A GLU 201 ? 1_555 76.4 ? 45 O ? A GLY 74 ? A GLY 178 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OE2 ? A GLU 97 ? A GLU 201 ? 1_555 79.4 ? 46 O ? A ILE 76 ? A ILE 180 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OE2 ? A GLU 97 ? A GLU 201 ? 1_555 101.7 ? 47 OD1 ? A ASP 94 ? A ASP 198 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OE2 ? A GLU 97 ? A GLU 201 ? 1_555 119.2 ? 48 OD2 ? A ASP 94 ? A ASP 198 ? 1_555 CA ? E CA . ? A CA 267 ? 1_555 OE2 ? A GLU 97 ? A GLU 201 ? 1_555 78.7 ? 49 O ? A GLY 86 ? A GLY 190 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 O ? A ILE 87 ? A ILE 191 ? 1_555 69.8 ? 50 O ? A GLY 86 ? A GLY 190 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 O ? A GLY 88 ? A GLY 192 ? 1_555 80.3 ? 51 O ? A ILE 87 ? A ILE 191 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 O ? A GLY 88 ? A GLY 192 ? 1_555 58.0 ? 52 O ? A GLY 86 ? A GLY 190 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 OD2 ? A ASP 90 ? A ASP 194 ? 1_555 84.6 ? 53 O ? A ILE 87 ? A ILE 191 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 OD2 ? A ASP 90 ? A ASP 194 ? 1_555 58.7 ? 54 O ? A GLY 88 ? A GLY 192 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 OD2 ? A ASP 90 ? A ASP 194 ? 1_555 116.3 ? 55 O ? A GLY 86 ? A GLY 190 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 OD1 ? A ASP 90 ? A ASP 194 ? 1_555 134.4 ? 56 O ? A ILE 87 ? A ILE 191 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 OD1 ? A ASP 90 ? A ASP 194 ? 1_555 77.2 ? 57 O ? A GLY 88 ? A GLY 192 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 OD1 ? A ASP 90 ? A ASP 194 ? 1_555 107.8 ? 58 OD2 ? A ASP 90 ? A ASP 194 ? 1_555 CA ? F CA . ? A CA 268 ? 1_555 OD1 ? A ASP 90 ? A ASP 194 ? 1_555 51.0 ? 59 NE2 ? A HIS 114 ? A HIS 218 ? 1_555 ZN ? B ZN . ? A ZN 264 ? 1_555 NE2 ? A HIS 118 ? A HIS 222 ? 1_555 79.8 ? 60 NE2 ? A HIS 114 ? A HIS 218 ? 1_555 ZN ? B ZN . ? A ZN 264 ? 1_555 NE2 ? A HIS 124 ? A HIS 228 ? 1_555 109.1 ? 61 NE2 ? A HIS 118 ? A HIS 222 ? 1_555 ZN ? B ZN . ? A ZN 264 ? 1_555 NE2 ? A HIS 124 ? A HIS 228 ? 1_555 80.1 ? 62 NE2 ? A HIS 114 ? A HIS 218 ? 1_555 ZN ? B ZN . ? A ZN 264 ? 1_555 O4 ? G NGH . ? A NGH 269 ? 1_555 77.4 ? 63 NE2 ? A HIS 118 ? A HIS 222 ? 1_555 ZN ? B ZN . ? A ZN 264 ? 1_555 O4 ? G NGH . ? A NGH 269 ? 1_555 97.0 ? 64 NE2 ? A HIS 124 ? A HIS 228 ? 1_555 ZN ? B ZN . ? A ZN 264 ? 1_555 O4 ? G NGH . ? A NGH 269 ? 1_555 172.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-04-19 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.value' 23 4 'Structure model' '_struct_conn.pdbx_dist_value' 24 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 30 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 31 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 36 4 'Structure model' '_struct_ref_seq_dif.details' 37 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 38 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 39 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A VAL 108 ? ? CA A VAL 108 ? ? C A VAL 108 ? ? 95.62 111.40 -15.78 1.90 N 2 1 CB A LEU 181 ? ? CA A LEU 181 ? ? C A LEU 181 ? ? 121.66 110.20 11.46 1.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 108 ? ? 136.21 36.67 2 1 ARG A 110 ? ? 11.27 -77.04 3 1 LYS A 111 ? ? -137.03 -69.91 4 1 HIS A 112 ? ? 63.85 -66.54 5 1 ALA A 164 ? ? -123.30 -168.63 6 1 ALA A 173 ? ? 64.04 -67.00 7 1 ASP A 175 ? ? -174.64 20.97 8 1 HIS A 228 ? ? 7.84 113.75 9 1 PHE A 248 ? ? 40.64 85.02 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 TRP A 109 ? ? ARG A 110 ? ? 116.90 2 1 TYR A 262 ? ? GLY A 263 ? ? -38.93 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 110 ? ? 0.081 'SIDE CHAIN' 2 1 TYR A 116 ? ? 0.089 'SIDE CHAIN' 3 1 ARG A 127 ? ? 0.093 'SIDE CHAIN' 4 1 PHE A 149 ? ? 0.240 'SIDE CHAIN' 5 1 PHE A 163 ? ? 0.113 'SIDE CHAIN' 6 1 ASP A 194 ? ? 0.070 'SIDE CHAIN' 7 1 HIS A 196 ? ? 0.120 'SIDE CHAIN' 8 1 HIS A 218 ? ? 0.098 'SIDE CHAIN' 9 1 PHE A 248 ? ? 0.127 'SIDE CHAIN' 10 1 TYR A 262 ? ? 0.167 'SIDE CHAIN' # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id VAL _pdbx_validate_chiral.auth_seq_id 108 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CALCIUM ION' CA 4 'N-ISOBUTYL-N-[4-METHOXYPHENYLSULFONYL]GLYCYL HYDROXAMIC ACID' NGH #