data_1Z7P # _entry.id 1Z7P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Z7P pdb_00001z7p 10.2210/pdb1z7p/pdb RCSB RCSB032402 ? ? WWPDB D_1000032402 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 6410 'Chemical Shift Assiggnment' unspecified PDB 1Z7R 'minimized average structure' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Z7P _pdbx_database_status.recvd_initial_deposition_date 2005-03-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Feng, Y.' 1 'Zhong, N.' 2 'Rouhier, N.' 3 'Jacquot, J.P.' 4 'Xia, B.' 5 # _citation.id primary _citation.title 'Structural Insight into Poplar Glutaredoxin C1 with a Bridging Iron-Sulfur Cluster at the Active Site' _citation.journal_abbrev Biochemistry _citation.journal_volume 45 _citation.page_first 7998 _citation.page_last 8008 _citation.year 2006 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16800625 _citation.pdbx_database_id_DOI 10.1021/bi060444t # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Feng, Y.' 1 ? primary 'Zhong, N.' 2 ? primary 'Rouhier, N.' 3 ? primary 'Hase, T.' 4 ? primary 'Kusunoki, M.' 5 ? primary 'Jacquot, J.P.' 6 ? primary 'Jin, C.' 7 ? primary 'Xia, B.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description glutaredoxin _entity.formula_weight 12529.306 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'glutaredoxin C1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFI GGKQIGGCDTVVEKHQRNELLPLLQDAAATAKNPAQL ; _entity_poly.pdbx_seq_one_letter_code_can ;MASKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFI GGKQIGGCDTVVEKHQRNELLPLLQDAAATAKNPAQL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 LYS n 1 5 GLN n 1 6 GLU n 1 7 LEU n 1 8 ASP n 1 9 ALA n 1 10 ALA n 1 11 LEU n 1 12 LYS n 1 13 LYS n 1 14 ALA n 1 15 LYS n 1 16 GLU n 1 17 LEU n 1 18 ALA n 1 19 SER n 1 20 SER n 1 21 ALA n 1 22 PRO n 1 23 VAL n 1 24 VAL n 1 25 VAL n 1 26 PHE n 1 27 SER n 1 28 LYS n 1 29 THR n 1 30 TYR n 1 31 CYS n 1 32 GLY n 1 33 TYR n 1 34 CYS n 1 35 ASN n 1 36 ARG n 1 37 VAL n 1 38 LYS n 1 39 GLN n 1 40 LEU n 1 41 LEU n 1 42 THR n 1 43 GLN n 1 44 VAL n 1 45 GLY n 1 46 ALA n 1 47 SER n 1 48 TYR n 1 49 LYS n 1 50 VAL n 1 51 VAL n 1 52 GLU n 1 53 LEU n 1 54 ASP n 1 55 GLU n 1 56 LEU n 1 57 SER n 1 58 ASP n 1 59 GLY n 1 60 SER n 1 61 GLN n 1 62 LEU n 1 63 GLN n 1 64 SER n 1 65 ALA n 1 66 LEU n 1 67 ALA n 1 68 HIS n 1 69 TRP n 1 70 THR n 1 71 GLY n 1 72 ARG n 1 73 GLY n 1 74 THR n 1 75 VAL n 1 76 PRO n 1 77 ASN n 1 78 VAL n 1 79 PHE n 1 80 ILE n 1 81 GLY n 1 82 GLY n 1 83 LYS n 1 84 GLN n 1 85 ILE n 1 86 GLY n 1 87 GLY n 1 88 CYS n 1 89 ASP n 1 90 THR n 1 91 VAL n 1 92 VAL n 1 93 GLU n 1 94 LYS n 1 95 HIS n 1 96 GLN n 1 97 ARG n 1 98 ASN n 1 99 GLU n 1 100 LEU n 1 101 LEU n 1 102 PRO n 1 103 LEU n 1 104 LEU n 1 105 GLN n 1 106 ASP n 1 107 ALA n 1 108 ALA n 1 109 ALA n 1 110 THR n 1 111 ALA n 1 112 LYS n 1 113 ASN n 1 114 PRO n 1 115 ALA n 1 116 GLN n 1 117 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Populus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Populus tremula x Populus tremuloides' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 47664 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5PSJ1_9ROSI _struct_ref.pdbx_db_accession Q5PSJ1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGG KQIGGCDTVVEKHQRNELLPLLQDAAATAK ; _struct_ref.pdbx_align_begin 12 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Z7P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5PSJ1 _struct_ref_seq.db_align_beg 12 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 112 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1Z7P MET A 1 ? UNP Q5PSJ1 ? ? 'cloning artifact' 1 1 1 1Z7P ALA A 2 ? UNP Q5PSJ1 ? ? 'cloning artifact' 2 2 1 1Z7P ASN A 113 ? UNP Q5PSJ1 ? ? 'SEE REMARK 999' 113 3 1 1Z7P PRO A 114 ? UNP Q5PSJ1 ? ? 'SEE REMARK 999' 114 4 1 1Z7P ALA A 115 ? UNP Q5PSJ1 ? ? 'SEE REMARK 999' 115 5 1 1Z7P GLN A 116 ? UNP Q5PSJ1 ? ? 'SEE REMARK 999' 116 6 1 1Z7P LEU A 117 ? UNP Q5PSJ1 ? ? 'SEE REMARK 999' 117 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 '3D_13C-separated_NOESY in aromatic region' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '40mM potassium phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.1mM uniformly 13C/15N-labeled protein, 40mM potassium phosphate buffer, 90% H2O/10% D2O, 40mM DTT, 0.01% NaN3 and 0.01% DSS, protease inhibitor cocktail ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 500 ? 2 AVANCE Bruker 600 ? # _pdbx_nmr_refine.entry_id 1Z7P _pdbx_nmr_refine.method 'molecular dynamics simulated annealing' _pdbx_nmr_refine.details 'CYS 31 is present as the thiolate with a negative charge on the sulfur.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1Z7P _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CYANA 1.0.6 'Guntert, P.' 1 refinement Amber 7 'Case, D. A.' 2 'data analysis' NMRView 5.2.2 'Johnson, B. A.' 3 processing NMRPipe 2.3 'Delaglio, F.' 4 # _exptl.entry_id 1Z7P _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1Z7P _struct.title 'Solution structure of reduced glutaredoxin C1 from Populus tremula x tremuloides' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Z7P _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? SER A 20 ? SER A 3 SER A 20 1 ? 18 HELX_P HELX_P2 2 CYS A 31 ? GLY A 45 ? CYS A 31 GLY A 45 1 ? 15 HELX_P HELX_P3 3 ASP A 58 ? GLY A 71 ? ASP A 58 GLY A 71 1 ? 14 HELX_P HELX_P4 4 CYS A 88 ? ARG A 97 ? CYS A 88 ARG A 97 1 ? 10 HELX_P HELX_P5 5 GLU A 99 ? ALA A 107 ? GLU A 99 ALA A 107 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 1 -10.06 2 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 2 -11.13 3 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 3 -9.75 4 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 4 -10.75 5 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 5 -10.12 6 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 6 -10.14 7 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 7 -10.62 8 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 8 -7.26 9 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 9 -8.78 10 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 10 -10.03 11 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 11 -10.18 12 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 12 -10.07 13 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 13 -8.67 14 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 14 -10.10 15 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 15 -10.76 16 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 16 -10.10 17 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 17 -9.01 18 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 18 -10.33 19 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 19 -10.33 20 VAL 75 A . ? VAL 75 A PRO 76 A ? PRO 76 A 20 -10.04 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 49 ? GLU A 52 ? LYS A 49 GLU A 52 A 2 VAL A 23 ? SER A 27 ? VAL A 23 SER A 27 A 3 ASN A 77 ? ILE A 80 ? ASN A 77 ILE A 80 A 4 LYS A 83 ? GLY A 87 ? LYS A 83 GLY A 87 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 49 ? O LYS A 49 N VAL A 23 ? N VAL A 23 A 2 3 N PHE A 26 ? N PHE A 26 O ASN A 77 ? O ASN A 77 A 3 4 N VAL A 78 ? N VAL A 78 O GLY A 86 ? O GLY A 86 # _database_PDB_matrix.entry_id 1Z7P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1Z7P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 LEU 117 117 117 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-03-28 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH2 A ARG 97 ? ? 117.28 120.30 -3.02 0.50 N 2 10 NE A ARG 97 ? ? CZ A ARG 97 ? ? NH2 A ARG 97 ? ? 117.23 120.30 -3.07 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -72.72 32.31 2 1 ARG A 72 ? ? -140.73 -63.24 3 1 ALA A 108 ? ? 48.44 28.48 4 1 GLN A 116 ? ? 67.75 163.05 5 2 ASN A 113 ? ? -157.02 73.45 6 2 ALA A 115 ? ? -143.40 -87.04 7 3 ALA A 2 ? ? -78.47 45.72 8 3 GLN A 116 ? ? 64.04 -178.26 9 4 ARG A 72 ? ? -146.39 51.68 10 4 ASN A 113 ? ? -153.03 88.87 11 4 GLN A 116 ? ? 63.97 -179.05 12 5 ARG A 72 ? ? -90.58 -62.87 13 5 ALA A 108 ? ? 49.51 24.36 14 5 ALA A 111 ? ? 53.26 16.33 15 6 ALA A 2 ? ? 57.19 19.76 16 6 ARG A 72 ? ? -152.14 62.77 17 6 GLN A 116 ? ? 46.31 -164.21 18 7 ARG A 72 ? ? -137.59 -59.67 19 7 ALA A 111 ? ? 49.97 26.43 20 8 ALA A 111 ? ? 47.56 28.27 21 9 ALA A 108 ? ? 54.25 16.77 22 9 ASN A 113 ? ? 37.41 57.99 23 9 ALA A 115 ? ? -72.99 -80.43 24 10 ARG A 72 ? ? -127.35 -53.94 25 10 ASN A 113 ? ? 31.98 65.91 26 10 GLN A 116 ? ? 65.00 172.71 27 11 ARG A 72 ? ? -143.12 -43.04 28 12 ARG A 72 ? ? -139.54 -55.73 29 12 ALA A 115 ? ? -150.60 -29.60 30 13 ALA A 111 ? ? -61.44 96.03 31 13 PRO A 114 ? ? -48.59 -8.28 32 13 GLN A 116 ? ? 62.36 -178.54 33 14 ASN A 113 ? ? -168.13 90.17 34 14 ALA A 115 ? ? -153.39 -41.91 35 15 ARG A 72 ? ? -140.76 -62.32 36 15 ALA A 115 ? ? -87.41 -143.44 37 16 ALA A 115 ? ? -83.60 -136.40 38 17 ASN A 113 ? ? -161.95 86.41 39 17 GLN A 116 ? ? 66.83 170.75 40 18 ALA A 111 ? ? 49.51 25.97 41 18 GLN A 116 ? ? 56.23 -178.08 42 19 ARG A 72 ? ? -145.73 54.17 43 19 ALA A 108 ? ? 48.98 27.79 44 20 TYR A 30 ? ? -142.75 -8.13 45 20 ARG A 72 ? ? -130.77 -62.41 #