data_1ZFO # _entry.id 1ZFO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZFO pdb_00001zfo 10.2210/pdb1zfo/pdb WWPDB D_1000177473 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZFO _pdbx_database_status.recvd_initial_deposition_date 1996-05-06 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hammarstrom, A.' 1 'Berndt, K.D.' 2 'Sillard, R.' 3 'Adermann, K.' 4 'Otting, G.' 5 # _citation.id primary _citation.title ;Solution structure of a naturally-occurring zinc-peptide complex demonstrates that the N-terminal zinc-binding module of the Lasp-1 LIM domain is an independent folding unit. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 35 _citation.page_first 12723 _citation.page_last 12732 _citation.year 1996 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8841116 _citation.pdbx_database_id_DOI 10.1021/bi961149j # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hammarstrom, A.' 1 ? primary 'Berndt, K.D.' 2 ? primary 'Sillard, R.' 3 ? primary 'Adermann, K.' 4 ? primary 'Otting, G.' 5 ? # _cell.entry_id 1ZFO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ZFO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man LASP-1 3549.239 1 ? ? 'ZF-1 AMINO-TERMINAL LIM-DOMAIN PEPTIDE' 'IDENTICAL TO 30 N-TERMINAL RESIDUES OF HUMAN LASP-1' 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)MNPNCARCGKIVYPTEKVNCLDKFWHKACF' _entity_poly.pdbx_seq_one_letter_code_can XMNPNCARCGKIVYPTEKVNCLDKFWHKACF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 MET n 1 3 ASN n 1 4 PRO n 1 5 ASN n 1 6 CYS n 1 7 ALA n 1 8 ARG n 1 9 CYS n 1 10 GLY n 1 11 LYS n 1 12 ILE n 1 13 VAL n 1 14 TYR n 1 15 PRO n 1 16 THR n 1 17 GLU n 1 18 LYS n 1 19 VAL n 1 20 ASN n 1 21 CYS n 1 22 LEU n 1 23 ASP n 1 24 LYS n 1 25 PHE n 1 26 TRP n 1 27 HIS n 1 28 LYS n 1 29 ALA n 1 30 CYS n 1 31 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name pig _entity_src_gen.gene_src_genus Sus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ INTESTINE _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LASP1_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P80171 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MNPNCARCGKIVYPTEKVNCLDKFWHKACF _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZFO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P80171 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 30 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_ensemble.entry_id 1ZFO _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name OPAL _pdbx_nmr_software.version ? _pdbx_nmr_software.authors LUGINBUHL,GUNTERT,BILLETER,WUTHRICH _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1ZFO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ZFO _struct.title 'AMINO-TERMINAL LIM-DOMAIN PEPTIDE OF LASP-1, NMR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZFO _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'LIM DOMAIN, ZINC-FINGER, METAL-BINDING PROTEIN, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 14 ? LYS A 18 ? TYR A 13 LYS A 17 5 ? 5 HELX_P HELX_P2 2 HIS A 27 ? PHE A 31 ? HIS A 26 PHE A 30 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A MET 2 N ? ? A ACE 0 A MET 1 1_555 ? ? ? ? ? ? ? 1.336 ? ? metalc1 metalc ? ? A CYS 6 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 5 A ZN 31 1_555 ? ? ? ? ? ? ? 2.299 ? ? metalc2 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 31 1_555 ? ? ? ? ? ? ? 2.283 ? ? metalc3 metalc ? ? A HIS 27 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 31 1_555 ? ? ? ? ? ? ? 1.979 ? ? metalc4 metalc ? ? A CYS 30 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 31 1_555 ? ? ? ? ? ? ? 2.319 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 2 ? S2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S2 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 LYS A 11 ? VAL A 13 ? LYS A 10 VAL A 12 S1 2 PRO A 4 ? ALA A 7 ? PRO A 3 ALA A 6 S2 1 PHE A 25 ? HIS A 27 ? PHE A 24 HIS A 26 S2 2 LYS A 18 ? VAL A 19 ? LYS A 17 VAL A 18 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O LYS A 11 ? O LYS A 10 N CYS A 6 ? N CYS A 5 S2 1 2 O TRP A 26 ? O TRP A 25 N VAL A 19 ? N VAL A 18 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 31 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 31' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 6 ? CYS A 5 . ? 1_555 ? 2 AC1 4 CYS A 9 ? CYS A 8 . ? 1_555 ? 3 AC1 4 HIS A 27 ? HIS A 26 . ? 1_555 ? 4 AC1 4 CYS A 30 ? CYS A 29 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ZFO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZFO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 ASN 3 2 2 ASN ASN A . n A 1 4 PRO 4 3 3 PRO PRO A . n A 1 5 ASN 5 4 4 ASN ASN A . n A 1 6 CYS 6 5 5 CYS CYS A . n A 1 7 ALA 7 6 6 ALA ALA A . n A 1 8 ARG 8 7 7 ARG ARG A . n A 1 9 CYS 9 8 8 CYS CYS A . n A 1 10 GLY 10 9 9 GLY GLY A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 VAL 13 12 12 VAL VAL A . n A 1 14 TYR 14 13 13 TYR TYR A . n A 1 15 PRO 15 14 14 PRO PRO A . n A 1 16 THR 16 15 15 THR THR A . n A 1 17 GLU 17 16 16 GLU GLU A . n A 1 18 LYS 18 17 17 LYS LYS A . n A 1 19 VAL 19 18 18 VAL VAL A . n A 1 20 ASN 20 19 19 ASN ASN A . n A 1 21 CYS 21 20 20 CYS CYS A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 ASP 23 22 22 ASP ASP A . n A 1 24 LYS 24 23 23 LYS LYS A . n A 1 25 PHE 25 24 24 PHE PHE A . n A 1 26 TRP 26 25 25 TRP TRP A . n A 1 27 HIS 27 26 26 HIS HIS A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 ALA 29 28 28 ALA ALA A . n A 1 30 CYS 30 29 29 CYS CYS A . n A 1 31 PHE 31 30 30 PHE PHE A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 31 _pdbx_nonpoly_scheme.auth_seq_num 31 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 6 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 SG ? A CYS 9 ? A CYS 8 ? 1_555 97.5 ? 2 SG ? A CYS 6 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 ND1 ? A HIS 27 ? A HIS 26 ? 1_555 110.0 ? 3 SG ? A CYS 9 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 ND1 ? A HIS 27 ? A HIS 26 ? 1_555 104.6 ? 4 SG ? A CYS 6 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 SG ? A CYS 30 ? A CYS 29 ? 1_555 110.0 ? 5 SG ? A CYS 9 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 SG ? A CYS 30 ? A CYS 29 ? 1_555 113.6 ? 6 ND1 ? A HIS 27 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 SG ? A CYS 30 ? A CYS 29 ? 1_555 119.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-11-08 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_keywords 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_keywords.text' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 7 ? ? -122.55 -57.49 2 1 LYS A 17 ? ? -68.40 79.96 3 1 ASP A 22 ? ? -154.84 -1.17 4 2 ARG A 7 ? ? -126.56 -54.96 5 2 LYS A 17 ? ? -20.89 97.96 6 2 CYS A 20 ? ? -144.48 -155.33 7 2 LEU A 21 ? ? -46.25 -72.27 8 2 ASP A 22 ? ? -151.68 16.18 9 3 ALA A 6 ? ? -69.49 6.76 10 3 ARG A 7 ? ? -94.27 -70.60 11 3 GLU A 16 ? ? -141.83 50.01 12 3 LEU A 21 ? ? 165.58 179.10 13 4 GLU A 16 ? ? -144.33 45.21 14 4 CYS A 20 ? ? -141.65 25.90 15 4 LEU A 21 ? ? -150.95 -95.19 16 4 ASP A 22 ? ? -151.56 4.71 17 5 ARG A 7 ? ? -95.33 -67.80 18 5 GLU A 16 ? ? -105.94 -73.51 19 5 LYS A 17 ? ? 23.90 74.53 20 5 LEU A 21 ? ? -151.59 -152.98 21 6 ARG A 7 ? ? -93.83 -69.63 22 6 LYS A 17 ? ? -47.49 95.87 23 6 CYS A 20 ? ? -150.30 -143.79 24 6 LEU A 21 ? ? -44.84 -73.92 25 6 ASP A 22 ? ? -155.91 22.18 26 7 ARG A 7 ? ? -95.12 -69.24 27 8 THR A 15 ? ? -144.96 -72.96 28 8 LYS A 17 ? ? -52.33 97.55 29 8 CYS A 20 ? ? -154.42 24.21 30 8 LEU A 21 ? ? 158.57 174.82 31 9 THR A 15 ? ? 173.93 -23.27 32 9 TRP A 25 ? ? -136.54 -158.00 33 10 PRO A 3 ? ? -59.79 173.32 34 10 ARG A 7 ? ? -94.62 -66.98 35 10 LYS A 17 ? ? -53.43 93.25 36 10 LEU A 21 ? ? -152.54 -95.85 37 10 LYS A 27 ? ? -34.05 -71.06 38 11 THR A 15 ? ? 173.79 -65.36 39 11 LYS A 17 ? ? -42.33 64.44 40 11 VAL A 18 ? ? -53.59 107.18 41 11 LEU A 21 ? ? -149.61 -91.39 42 12 ALA A 6 ? ? -63.80 6.17 43 13 LYS A 17 ? ? -51.77 106.00 44 13 LEU A 21 ? ? -165.22 -156.67 45 13 ASP A 22 ? ? -83.71 43.94 46 13 LYS A 27 ? ? -37.62 -70.28 47 14 LYS A 17 ? ? -35.65 110.97 48 14 CYS A 20 ? ? -145.70 -158.76 49 14 LEU A 21 ? ? -34.39 -72.25 50 15 ARG A 7 ? ? -94.16 -68.55 51 15 THR A 15 ? ? -162.97 -23.71 52 15 CYS A 20 ? ? -142.92 19.64 53 15 LEU A 21 ? ? -154.89 -92.50 54 15 ASP A 22 ? ? -155.03 11.82 55 15 LYS A 27 ? ? -34.22 -79.73 56 16 ARG A 7 ? ? -103.76 -64.37 57 16 CYS A 20 ? ? -148.93 -139.33 58 16 ASP A 22 ? ? -156.33 27.39 59 17 LYS A 17 ? ? -59.70 94.45 60 17 ASP A 22 ? ? -132.69 -56.81 61 18 ALA A 6 ? ? -72.05 22.74 62 18 ARG A 7 ? ? -129.89 -58.88 63 18 LYS A 17 ? ? -64.32 91.39 64 18 ASP A 22 ? ? -156.37 56.12 65 18 LYS A 27 ? ? -34.22 -70.57 66 19 ARG A 7 ? ? -93.67 -68.45 67 19 LYS A 17 ? ? -56.40 96.78 68 19 CYS A 20 ? ? -146.32 -143.06 69 19 LEU A 21 ? ? -51.68 -74.12 70 19 ASP A 22 ? ? -155.36 2.77 71 20 PRO A 14 ? ? -66.19 95.23 72 20 THR A 15 ? ? 173.91 -37.51 73 20 LEU A 21 ? ? -34.39 -72.44 74 20 ASP A 22 ? ? -142.93 18.81 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 6 ARG A 7 ? ? 0.107 'SIDE CHAIN' 2 19 ARG A 7 ? ? 0.114 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #